Storing and accessing the largest astronomical catalogues with the SAI CAS project S. Koposov1,2,3, O. Bartunov2, S. Karpov4 et al2. ... Why we want to build our own Catalogue Access Service The requirements for our CAS system The importance of the Database for the CAS (PostgreSQL & Q3C) The technical realization of CAS What has been already done Example of work TODO Storing and Accessing Astronomical Catalogues Existing projects CDS OpenSkyQuery CASjobs with SDSS They are all really great! ...

Еще в разделе: (Показать все результаты (>514) - lnfm1.sai.msu.ru/ )

• http://lnfm1.sai.msu.ru/~tempus/english/science/articles/ZotovPoster_APSG2013.pdf
• HSFA 2 technical description Technical Details

... Alexander Gusev, Sternberg Astronomical Institute . Andrei Tokovinin, National Optical Astronomy Observatory . ... Antonia M. Varela, Instituto de Astrofisica de Canarias . ... Behnam Javanmardi, Shiraz University-Biruni Observatory . Boris Safonov, Sternberg Astronomical Institute . ... Davoud Afshari, Zanjan University . ... Florian Kerber, European Southern Observatory . Gianluca Lombardi, European Southern Observatory . ... Hiroshi Matsuo, National Astronomical Observatory of Japan . ...

Еще в разделе: (Показать все результаты (>28) - site2010.sai.msu.ru/ )

• General information
• Observatories
• The album list

Correction of solar dopplergrams' large-scale flatfield" . Patrickeyev I.A., Mashnich G.P., Khlystova A.I., Zhang H. The authors have proposed and compared three different methods of large-scale flatfield correction (time averaging, Fourier filtering, and wavelet-based filtering). ... Patrickeyev I.A. - Institute of Continuum Mechanics, Russian Academy of Sciences, Korolyova 1, 614013, Perm, Russia; e-mail: pat@icmm.ru . ...

Еще в разделе: (Показать все результаты (>137) - num-meth.srcc.msu.ru/ )

• "Automation tools for the documentation of large software packages"
• "Stationary distribution for the Jacobi equation with a large random curvature
• Parallel partitioning tool GridSpiderPar for large mesh decomposition

Электронная библиотека Попечительского совета . ... Parker B.R. - Stairway to the Stars: The Story of the World's Largest Observatory . ... Название: Stairway to the Stars: The Story of the World's Largest Observatory . Автор: Parker B.R. Аннотация: . ... Stories concerning political, environmental, and scientific battles are . ... Электронная библиотека попечительского совета мехмата МГУ , 2004-2016 . ...

Еще в разделе: (Показать все результаты (>10277) - lib.mexmat.ru/ )

• Bely P. - The Design And Construction Of Large Optical Telescopes ::
• Saulis L., Statulevicius V.A. - Limit Theorems for Large Deviations ::
• Hollander Fr. - Large deviations :: Электронная библиотека попечительского

If you set the fastf option in $SYSTEM group to .true. (this option is turned on by default) and run PC GAMESS/Firefly under OS filesystem supporting large files, all files handled by FSF routines may have their size up to the native limits of 64-bit filesystems. ... FSF is an abbreviation of the Fast System Files - a powerful set of fast non- Fortran file I/O subroutines. By default, the FSF subroutines are used by the PC GAMESS/Firefly to perform almost all the file I/O operations. ...

Еще в разделе: (Показать все результаты (>81) - classic.chem.msu.su/ )

• PC GAMESS benchmarks and scalability on SKIF K-1000 - large Infiniband Opteron
• Firefly/PC GAMESS DOCUMENTATION - LARGE SCALE CI, MCSCF, and QDPT2
• Firefly/PC GAMESS DOCUMENTATION - LARGE SCALE MCQDPT2 and XMCQDPT2

... Day-by-day lines contain complete set and intended for those who have been there (I mean, in Kyoto :) . ... Large format is mainly for 1600x1200 screens and fast link (pictures are up to 150K in size). Normal is for typical 1024x768 screen (i.e. 15" monitors). ... Photos look incredible on it. ... Large . ... Normal . ... Thumbnails . ... Contents with thumbnails: Large | ... Nara, one of the historical cities of Japan . ... August 17, Sunday. ... Nara. ... return to photo album contents | ...

Еще в разделе: (Показать все результаты (>2797) - crydee.sai.msu.ru/ )

• Image: We are walking to large Buddhist temple near Kyoto station
• Image: Slope of the hill is covered by large stone staircase. Deers everywhere.
• Image: Near the large bell. On the right is Elena Benevolenskaya from St.

Astronomy . ... Institutions, Observatories . ... International Astronomical Union . ... Abastumani Astrophysical Observatory . Australian Astronomical Observatory . ... Byurakan Astrophysical Observatory . Hartebeesthoek Radio Astronomy Observatory . ... National Radio Astronomy Observatory . Nobeyama Radio Observatory . ... Pushchino Radio Astronomy Observatory . ... AGU journals . ... Astronomy and Astrophysics Springer . ... Astronomy Letters (ПАЖ) . ... Astrophysical Journal Letters . ...

Еще в разделе: (Показать все результаты (>220) - comet.sai.msu.ru/ )

• Ссылки
• Student's Astronomical Observatory
• Astronomical Circular - Contents

... Государственный Астрономический Институт имени П.К. Штернберга МГУ . ... Семинары ГАИШ . ... Государственный астрономический институт им. П.К.Штернберга (ГАИШ) научно-исследовательский институт, являющийся одним из подразделений МГУ им. М.В. Ломоносова . ... 11 декабря 2006 года исполнилось 175 лет со дня создания на Пресне Астрономической обсерватории Московского университета, ставшей впоследствии базой для формирования Государственного астрономического института им. П.К. Штернберга (ГАИШ МГУ). ...

Еще в разделе: (Показать все результаты (>166) - sai.msu.ru/ )

• Конференции сайта АстрО
• European Astronomical Society(EAS): NEWS

... Publications :: Large Layered Intrusions . ... Chalokwu C.I., Ariskin A.A., Koptev-Dvornikov E.V. (1996) Forward modeling of the incompatible element enrichment at the base of the Partridge River intrusion, Duluth Complex, Minnesota: Magma dynamics in a lower mushy zone. ... Krivolutskaya N.A., Ariskin A.A., Sluzhenikin S.F., Turovtsev D.M. Geochemical Thermometry of Rocks of the Talnakh Intrusion: Assessment of the Melt Composition and the Crystallinity of the Parental Magma. ... read >>] . ... Vol...

Еще в разделе: (Показать все результаты (>418) - geo.web.ru/ )

• Polygon - The Jewelry Industry's Largest Internet Marketplace - Все о Геологии

. [ Войти ] . Главная -> Фильмы -> Wanda at Large . Пользователи . Демо . Деньги . Фильмы . Форум . Wanda at Large . США 2003 . отметить . Сериал . Комедия .

Еще в разделе: (Показать все результаты (>79) - kinfo.ru/ )

• Dave Allen at Large - Фильмы - Kinfo.ru
• The Sims Livin' Large - Фильмы - Kinfo.ru
• Hero at Large - Фильмы - Kinfo.ru

... Moscow Lomonosov State University . ... Consider an open network consisting of N nodes (stations) and V(N) cars, which circulate among the stations. The network is divided into n clusters. ... Cluster j contains d N j N stations, Е j = 1 n d N j = 1. ... Later j and v denote cluster numbers and they take values from 1 to n. The arrival process to a station of cluster j is a Poisson one with the rate l j . ... The destination station in the cluster v is chosen uniformly. ...

Еще в разделе: (Показать все результаты (>46) - old.philol.msu.ru/ )

. S.I. Kudryashov, N.B. Zorov, A.A. Karabutov, Yu.Ya. Kuzyakov . Mendeleev Commun., v.1, p.22-24 (1997 ) . ABSTRACT . Vaporisation from rough surface areas during the laser ablation of foam graphite under vacuum generates a shock wave of recoil pressure of the vaporised substance which destroys the layer heated by radiation by desorbing large fragments from the material surface. Laboratory of Laser Diagnostics

Еще в разделе: (Показать все результаты (>320) - chem.msu.ru/ )

• Electric probe detection of large cluster ions in spinodal decomposition of the

... Large potentials of small heat shock proteins. ... HSPB1 directly or indirectly participates in the regulation of apoptosis, protects the cell against oxidative stress, and is involved in the regulation of the cytoskeleton. ... All small heat shock proteins play important "housekeeping" roles and regulate many vital processes; therefore, they are considered as attractive therapeutic targets. ...

Еще в разделе: (Показать все результаты (>50) - biochem.bio.msu.ru/ )

• Biochemistry Department of Moscow State University | Education

... Air pollution induced changes in pine needle chemistry were observed at sample sites in the surroundings of the Pechenganikel smelter. ... Close to the pollution source needles were enriched in Ni and Cu by needle age. Correlation and principal component analyses show that changes in the element composition of pine needles depended on air pollution and on natural factors as well. The contribution from air pollution increased with needle age. ...

Еще в разделе: (Показать все результаты (>20) - eco.soil.msu.ru/ )

. The work is supported by the Russian Foundation for Basic Research, grant 10-07-00685-a . PDB . Classification . Domain instances . Bonded with NA . 1BMV . VIRUS/RNA . 1 . 0 . 1PGL . VIRUS/RNA . 1 . 1 . total (2 entries) . 2 . 1 . No comments on this family . Send your questions and comments to sas@belozersky.msu.ru .

Еще в разделе: (Показать все результаты (>155) - monkey.belozersky.msu.ru/ )

• SCOP classification

. Выберите категорию обращения: Общие вопросы Отчеты Рейтинги Диссертационные советы Конкурсы Ввод данных Структура организаций Пользователи Проблемы с регистрацией\входом в систему . Тема обращения: . Описание проблемы: . Введите почтовый адрес: . Войти в систему . Регистрация . Главная . Поиск . Статистика . О проекте . Помощь . Издательство: Institute of Electrical and Electronics Engineers . Местоположение издательства: United States . ї 2011-2015 НИИ механики МГУ . Лаборатория 404. Все права защищены.

Еще в разделе: (Показать все результаты (>1992) - istina.msu.ru/ )

• Contributions of the Astronomical Observatory Skalnate Pleso - журнал | ИСТИНА
• Kosugi T. - сотрудник | ИСТИНА - Интеллектуальная Система Тематического
• Skopal A. - сотрудник | ИСТИНА - Интеллектуальная Система Тематического

... About lab . ... Conference "GraphiCon" . Online Journal "Computer graphics and multimedia" (in russian) . ... Large-lexicon attribute-consistent text recognition in natural images . ... Conference Paper . ... Conference Name . ... Project: Text detection and recognition in natural images . ...

Еще в разделе: (Показать все результаты (>73) - graphics.cs.msu.ru/ )

• A system for large-scale automatic traffic sign recognition and mapping |

... The role of wine tax-farming system in the forming of large capitals in Russia in the 19th century, . ... The article is devoted to one of the most profitable business activities in Russia at the end of the 18th century to the beginning of the 1860s. The author researches the social and national structure of wine tax-farmers, the level of their incomes as well as the ways and methods of accumulation of capital, in particular, their ties with the aristocracy and state officials of all levels. ...

Еще в разделе: (Показать все результаты (>88) - hist.msu.ru/ )

• Visual Images of Patriarch Nikon

AN ORIGIN FOR THE SOUTH POLE-AITKEN BASIN THORIUM. ... Moscow University. ... Introduction: The lunar South Pole-Aitken (SPA) impact basin is one of the largest and oldest impact basins and has thus been heavily degraded by postbasin-formation primary impacts and their ejecta [1]. ... The SPA basin thorium map: The using data Lunar Prospector [4] the thorium distribution map demonstrated a hemisphere of the Moon which contains the SPA basin structure and its environs was constructed. ...

Еще в разделе: (Показать все результаты (>126) - selena.sai.msu.ru/ )

• http://selena.sai.msu.ru/Greg/Publications/ms38/ms090.pdf
• http://selena.sai.msu.ru/Chik/Publications/Aitken/MS015.pdf
• Vladimir V. Busarev

sp|P0C6L4|LHDAG_HDV83 Large delta antigen ; MSQSETRRGRRGTREETLEKWITARKKAEELEKDLRKTRKTIKKLEEENPWLGNIVGIIR KGKDGEGAPPAKRPRTDQMEVDSGPGKRPHKSGFTDKEREDHRRRKALENKKKQLSAGGK ILSKEEEEELRRLTDEDEERKRRVAGPRVGDVNPSRGGPRGAPGGGFVPQMAGVPESPFS RTGEGLDIRGTQGFPWVSPSPPQQRLPLLECTPQ sp|P0C6L5|LHDAG_HDVAM Large delta ...

Еще в разделе: (Показать все результаты (>860) - kodomo.cmm.msu.ru/ )

• http://kodomo.fbb.msu.ru/~alex2308/align/delta.fasta
• http://kodomo.cmm.msu.ru/~golikov_v/practices/delta.fasta
• http://kodomo.fbb.msu.ru/~alex2308/align/delta_aligned.fasta