. Investigation of the physical and chemical properties of the soil planets, moons and asteroids remote methods. I have worked on the development of spectropolarimeters, CCD instrumentation, microcontrollers, etc. Photograph album . Gallery . Address of E-mail . Return . Department of Lunar . and Planetary Research .

Еще в разделе: (Показать все результаты (>87) - selena.sai.msu.ru/ )

• The CCD-chamber "Vega-202"
• Cunstkamera
• Vadim I. Chikmachov

PHP Manual . Prev . Next . Here is the list of PHP reserved words, usually constants and predefined variables . You won't find any functions here, but rather language constructs. You shouldn't try to use such names as variable, function, constant or method names, as it will surely lead to confusion. and . ... old_function . ... argc . ... PHP_OS . ... PHP_SELF . ... PHP_VERSION . ... function . ... HTTP_SERVER_VARS . ... list() . ... List of Function Aliases . ...

Еще в разделе: (Показать все результаты (>548) - oit.cmc.msu.ru/ )

... О физическом факультете . ... Журнал "Ученые записки физич. факультета МГУ" . ... Журнал "Ученые записки физического факультета МГУ" . ... Секция физики конференции "Ломоносовские чтения" будет работать на физическом факультете с 18 по 27 апреля 2016 г. 15.04.2016 Конференция проектных и исследовательских работ школьников 'От атома до галактики' . ... Заседания секции "Физика" конференции студентов, аспирантов и молодых ученых "Ломоносов 2016" на физическом факультете состоятся 14 апреля. ...

Еще в разделе: (Показать все результаты (>431) - phys.msu.ru/ )

Canada Business Service Centres) - CBSC : 28.05.2004 4046 ­ , , . 2001 Canada Business Service Centre. All rights reserved. Reprinted with permission. Further reproduction prohibited. ... Human Resources Development Canada). ... U.S. Small Business Administration) : « , - ». Saskatchewan Industry and Resources, Business and Co-operative Services). ...

Еще в разделе: (Показать все результаты (>46) - innovation.msu.ru/ )

• http://www.innovation.msu.ru/russian/venturecapital_rus.pdf
• http://www.innovation.msu.ru/russian/guidetomarketresearch_rus.pdf
• http://www.innovation.msu.ru/russian/marketingplanoutline_rus.pdf

Network Working Group D. Eastlake Request for Comments: 2606 A. Panitz BCP: 32 June 1999 Category: Best Current Practice Reserved Top Level DNS Names Status of this Memo This document specifies an Internet Best Current Practices for the Internet Community, and requests discussion and suggestions for improvements. ... Abstract To reduce the likelihood of conflict and confusion, a few top level domain names are reserved for use in private testing, as examples in documentation, and the like. ...

Еще в разделе: (Показать все результаты (>19810) - mirror.msu.net/ )

• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/pdfrfc/rfc2606.txt.pdf
• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/rfc5398.txt
• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/pdfrfc/rfc5398.txt.pdf

Listing of CSS class names emitted from TWiki core code and standard plugins, for the Dakar release. ... TWiki styles in core code . TWiki Styles in Plugins . ... TWiki Styles in Templates . ... Most html elements generated by TWiki core code now have Cascading Style Sheet (CSS) tags. Skin builders and others who want to change the appearance of the default TWiki installation or any of the skins can use this document to see what styles can be created for these html elements. ...

Еще в разделе: (Показать все результаты (>35944) - dualopt1.cmm.msu.ru/ )

• TWikiCss - TWiki - TWiki
• %TOPICTITLE% (6 vs. 7) - TWiki
• %TOPICTITLE% (1 vs. 2) - TWiki

. About the University . Application . FAQ . Electronic Resources . About the Faculty . Departments . Labs and Research Centres . Photo Archive . Please note that English & Russian versions of this site do not coinside . All rights reserved under Russian & International laws. Copyright © 1997-2011 Faculty of History, MSU. No part of this site may be reproduced electronically or otherwise without the prior written permission of the copyright owner.

Еще в разделе: (Показать все результаты (>37689) - hist.msu.ru/ )

... Research programm of the laboratory-chair< . ... Laboratory-chair of Discrete mechanics on a microscopic scale . ... Thus the structures of the physical world are not physical objects but physical processes. ... The primitive entity is called a material point. ... The value of the property “existence” of the material point varies from “the material point does not exist” to “the material point exists” by this process. ... Let call this structure a dynamical graph or a d-graph. ...

Еще в разделе: (Показать все результаты (>1121) - chronos.msu.ru/ )

• Status of the Institute
• Web resources
• On the Institute

. Copyright Nikita's Website Inc. All Rights Reserved. E-mail . Kalinin Nikita Vadimovich About Me Contacts . Hello, you are on my home page . My name is Kalinin Nikita. I am a PhD student of Moscow State University, physics department, Chair of Polymer and Crystal Physics. My hobbies . Football, travelling, skiing, skating, English, Computer science . Research interests . Liquid crystals . Scientific adviser . Emelyanenko Alexander Vyacheslavovich .

Еще в разделе: (Показать все результаты (>467) - polly.phys.msu.ru/ )

• http://polly.phys.msu.ru/~kalinin/gallery.html
• Welcome to my page
• Publications

The QWindow class is reserved for future extensions. More... #include < qwindow.h > . Inherits QWidget . ... QWindow  ( QWidget * parent=0, const char * name=0, WFlags f=0 )  . QWindow  ()  . ... This class is not yet finished. ... Constructs a window named name, which will be a child widget of parent. ... This file is part of the Qt toolkit , copyright 1995-98 Troll Tech , all rights reserved. ... qwindow.h: 1998/07/03 . qwindow.cpp: 1998/07/03 . Copyright © 1998 Troll Tech . ...

Еще в разделе: (Показать все результаты (>767) - rtm-cs.sinp.msu.ru/ )

• Qt Toolkit - forever/forever.cpp example file
• Apache module mod_status
• Qt Toolkit - dclock/dclock.cpp example file

... Для исследования была взята последовательность белка Malk_ecoli . ... Identities = 214/326 (65%), Positives = 257/326 (78%), Gaps = 13/326 (3%) Query 1 LRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGA 60 LR IAGLE ITSGDLFIGE+RMND P++RGVGMVFQSYALYPHL++ +NMSFGLKL+ A Sbjct 46 LRCIAGLEDITSGDLFIGEQRMNDVEPSKRGVGMVFQSYALYPHLNLYDNMSFGLKLSKA 105 Query 61 KKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLD 120 K I +RV+ AE+LQL+HLLDR+PKALSGGQRQRVAIGRTLV++P+VFLLDEPLSNLD ...

Еще в разделе: (Показать все результаты (>783) - kodomo.cmm.msu.ru/ )

• Term2
• Term1
• Pouliakhina's page

Boat tour and banquet on Moskva River . ... We have reserved a boat which goes by the Moskva River that crosses the city of Moscow. ... The advanced reservation by e-mail will be considered first. ... The ticket price is $25 for full participants (who have paid $250-$300), and $50 for the accompanying persons and those who paid reduced fee. ... Registration fee: full ($250-300), reduced, or student, or "no fee" (for the accompanying person.) ...

Еще в разделе: (Показать все результаты (>509) - acs366.phys.msu.su/ )

... International Laser Center and Faculty of Physics . M.V.Lomonosov Moscow State University . Moscow 119899 . ... 2016 Quantum Information Laboratory. ...

Еще в разделе: (Показать все результаты (>92) - qilab.phys.msu.ru/ )

... Geomorphology and Paleogeography . Geography of World Economy . ... Journal "MSU Vestnik", series "Geography" . ... Moscow, Geography Faculty MSU. 2000. 155 p. (in Russian) . ... Moscow: Faculty of Geography MSU. 2006. 346 p. Bolysov S.I. Biogeomorphology of continents. ... Moscow, Faculty of Geography MSU. ... Moscow, Faculty of Geography MSU. 2014. 116 p. Eremenko E.A., Panin A.V. Hollow mesotopography of the East European Plain. ... Moscow, Faculty of Geography MSU. 2008. 167 p. Links FAQ . ...

Еще в разделе: (Показать все результаты (>110) - eng.geogr.msu.ru/ )

• Department of Cryolithology and Glaciology
• Satino teaching and research station
• Department of Economic and Social Geography of Russia

The conference will take place at the Mathematical Research and Conference Center in Bedlewo , near Poznan. You can easily get to Poznan by train from Warsaw or Berlin. The participants are expected to arrive to Bedlewo on January 25. There will be reserved a bus from the Poznan train station "Poznan Glowny" to Bedlewo. Please wait for the bus in front of the main entrance of the station. The bus departure is expected to be at 7:00 p.m. There is also a small airport in Poznan. ...

Еще в разделе: (Показать все результаты (>277) - higeom.math.msu.su/ )

. Department of general physics . and magneto-ordered matter . Faculty of Physics . Moscow State University . General Information . Education . Scientific research . Main Info . At physics faculty . Research laboratories and groups . Staff . At natural faculties . Publications . Contacts . International collaboration . Russian Version . Server of Physics department . Main server of MSU

Еще в разделе: (Показать все результаты (>31) - ferro.phys.msu.ru/ )

... Certificate of State Registration of Database № 2008620382 . ... Post adress: Moscow 119991, Leninskie Gory 1, MSU, Department of Physics, chair of Quantum Electronics . ... 2016 Laboratory of laser spectroscopy of solutions of supramolecular compounds and nanostructures . ...

Еще в разделе: (Показать все результаты (>65) - rswater.phys.msu.ru/ )

• Лаборатория лазерной спектроскопии растворов супрамолекулярных соединений и

This module provides information on server activity and performance. ... Compatibility: Available in Apache 1.1 and later. ... ExtendedStatus To enable status reports only for browsers from the foo.com domain add this code to your httpd.conf configuration file <Location /server-status> SetHandler server-status Order Deny,Allow Deny from all Allow from .foo.com </Location> . ... A machine-readable version of the status file is available by accessing the page http://your.server.name/server-status?auto . ...

Еще в разделе: (Показать все результаты (>133) - neptun.sai.msu.ru/ )

• Apache HOWTO documentation
• Custom error responses
• Apache module mod_isapi

. Log-line: Greg Adams lost his beloved girlfriend Pam. His love was very strong and Greg forbids himself to start a relationship with another girl. To stifle his depression and loneliness Greg plays a game called Conquer Jane's Heart, which proposes a digital mind as opponent. He comes to recognize Pam in Jane. Download Treatment (PDF - 1.47 Mb) . Download Screenplay (PDF - 4.33 Mb) . all right reserved (WGA registration number: 1093828) .

Еще в разделе: (Показать все результаты (>385) - lnfm1.sai.msu.ru/ )

• э‰·‰© с€ў€ЉёЉ·№Ѕ - э№Ґ ѕ‰ўЏѕ…Љ єў€±Ґё‰†ҐҐ
• Server LNFM1

... Thurston C.M. - Language Is Served: Games, Writing Prompts, and Other Language Arts Activities on the Yummy Topic of Food . ... Название: Language Is Served: Games, Writing Prompts, and Other Language Arts Activities on the Yummy Topic of Food . ... Need an activity to help you teach a specific language arts skill? ... Language Is Served includes word games, writing prompts, lessons, and writing activities that involve research, creativity, and/or application of skills studied in class. ...

Еще в разделе: (Показать все результаты (>13226) - lib.mexmat.ru/ )

• Wit G.W. - Loss reserving methods :: Электронная библиотека попечительского
• Amin S., Das J., Goldshtein M. - Are You Being Served?: New Tools for Measuring
• Bragg R., Hunt C. - Windows Server 2003 Network Administration :: Электронная