The QDialog class is the base class of dialog windows. ... QDialog  ( QWidget * parent=0, const char * name=0, bool modal=FALSE, WFlags f=0 )  . ... This enters a local event loop, which is terminated when the modal dialog calls done () (or accept () or reject ()). ... Calls reject () if it is a modal dialog, or accepts the close event if it is a modeless dialog. ... Shows the dialog box on the screen, as QWidget::show () and enters a local event loop if this dialog is modal (see constructor). ...

Еще в разделе: (Показать все результаты (>607) - rtm-cs.sinp.msu.ru/ )

• Qt Toolkit - QMenuBar Class
• Qt Toolkit - QMainWindow Class
• Qt Toolkit - QGList Class

... This commit also contains example of defining Markup saving mixin: markups.IntMarkupMixin and a test for it. author . ... 9 container is iterable collection of items. 10 item is object getting markup data (new attribute). 11 . ... 32 def __init__ ( self , name , container , map_out = {}): . ... 40 def set_map_out ( self , map_out ): . ... 65 def __contains__ ( self , item ): . ... 88 def from_string ( cls , string , name , container , map_out = {}): . ... 94 self = cls ( name , container , map_out )...

Еще в разделе: (Показать все результаты (>12461) - kodomo.fbb.msu.ru/ )

• allpy: ddf85d0a8924 allpy/markup.py
• allpy: ca2cf2377bed allpy/markup.py
• allpy: a3ffdddb2a72 allpy/markup.py

. This diagram shows how the precedence rules may be used to achieve the effect of hidden internal borders. The two by two table is surrounded by a solid border. The HTML table specification and style rules following the image cause the vertical border between the two cells in the first row and the horizontal border between the two cells in the first column to disappear. Return to image.

Еще в разделе: (Показать все результаты (>2560) - crydee.sai.msu.ru/ )

• Dynamic HTML in Communicator
• Recursion

Welcome , Registration , and other StartingPoints ; TWiki history & Wiki style; All the docs.. ... Links to topics will be created automatically, as long as you follow these simple Text Formatting Rules. ... Changed: . ... GoodStyle is a WikiWord that links to the GoodStyle topic located in the current TWiki web. ... Do not create that topic; you would wreck this example!) ... WEB% : The current web, is TWiki . ... The current TWiki web is the default web. ... Plugins currently installed are: . ...

Еще в разделе: (Показать все результаты (>41367) - dualopt1.cmm.msu.ru/ )

• %TOPICTITLE% (22 vs. 23) - TWiki
• %TOPICTITLE% (25 vs. 26) - TWiki
• TextFormattingRules - TWiki - TWiki

What is a Handler . ... mod_actions . ... A "handler" is an internal Apache representation of the action to be performed when a file is called. Generally, files have implicit handlers, based on the file type. Normally, all files are simply served by the server, but certain file types are "handled" separately. Apache 1.1 adds the ability to use handlers explicitly. ... The following directives will enable the send-as-is handler, which is used for files which contain their own HTTP headers. ...

Еще в разделе: (Показать все результаты (>109) - neptun.sai.msu.ru/ )

• Apache Multiple Log Files
• Apache module mod_example
• VirtualHost Examples

... Apache HTTP Server Version 2.0 . ... This document describes the use of Apache's Handlers. ... A "handler" is an internal Apache representation of the action to be performed when a file is called. Generally, files have implicit handlers, based on the file type. Normally, all files are simply served by the server, but certain file types are "handled" separately. ... The following directives will enable the send-as-is handler, which is used for files which contain their own HTTP headers. ...

Еще в разделе: (Показать все результаты (>522) - itpm.msu.su/ )

• mod_ext_filter - Apache HTTP Server
• VirtualHost Examples - Apache HTTP Server
• mod_dav - Apache HTTP Server

To check the identity of a single file: file ReportA ReportA: Frame Maker document . ... To check the identity of several files: file * external.c: c program text external.h: c program text mc: sparc demand paged dynamically linked executable mcXThelp: executable shell script mcdemo: executable shell script mchelp: executable shell script mchome: executable shell script mctools: executable shell script . This checks the identity of every file in the current directory. ...

Еще в разделе: (Показать все результаты (>497) - comet.sai.msu.ru/ )

• Examples of environment variable names
• Examples of quoting special characters
• Examples of using the ls command

... Internal declaration of zend_module_entry . typedef struct _ zend _ module _entry zend _ module _entry; struct _ zend _ module _entry { unsigned short size; unsigned int zend _api; unsigned char zend _debug; unsigned char zts; char * name ; zend _ function _entry * functions ; int (* module _startup_func)(INIT_FUNC_ARGS); int (* module _ shutdown _func)( SHUTDOWN _FUNC_ARGS); int (*request_startup_func)(INIT_FUNC_ARGS); int (*request_ shutdown _func)( ... functions . ... module_shutdown_func . ...

Еще в разделе: (Показать все результаты (>1037) - oit.cmc.msu.ru/ )

• Declaration of the Zend Function Block
• Apache's Handler Use
• YAZ functions

Described below are two methods for preparing input files with basis sets and ECPs which are not currently built in. ... Put basis sets and ECPs in directories (called here def2_svp_BAS and def2_ecp_ECP but you can call them whatever you want) and copy them to the Firefly directory. ... Both methods can also be used for preparing gamess (us) files - the check runs may not terminate properly due to certain keywords, but a useable file called 'input' is normally generated. ...

Еще в разделе: (Показать все результаты (>71) - classic.chem.msu.su/ )

• Potential Energy Surfaces with PC GAMESS/Firefly

... The recommended order is: # Serversettings: # logoutput # internal # external # method # clientmethod # users # compatibility # extension # connecttimeout # iotimeout # srchost # # Rules: # client block / pass # from to # log # # block / pass # from to # method # command # log # protocol # proxyprotocol # the server will log both via syslog, to stdout and to /var/ log /lotsoflogs #logoutput: syslog stdout /var/ ... All our clients come from the net 10.0.0.0/8. ...

Еще в разделе: (Показать все результаты (>21767) - mirror.msu.net/ )

• http://mirror.msu.net/pub/gentoo-portage/sci-geosciences/qgis/qgis-2.12.2.ebuild
• http://mirror.msu.net/pub/gentoo-portage/dev-db/cppdb/cppdb-0.3.1-r1.ebuild
• http://mirror.msu.net/pub/gentoo-portage/dev-util/build/build-0.3.9.ebuild

... 2011/12/09 . ... added alignment merging . added parameter corresponding to the width of output alignment . fixed homologue searching for very long query sequences . ... Copyright 2010-2011 Yury Pekov ...

Еще в разделе: (Показать все результаты (>13) - mouse.genebee.msu.ru/ )

• Align tool for DNA-protein complexes
• ConClus

Электронная библиотека Попечительского совета . ... Baird K.C. - Ruby by Example: Concepts and Code . ... Название: Ruby by Example: Concepts and Code . Автор: Baird K.C. Аннотация: . ... Ruby by Example analyzes a series of Ruby scripts, examining how the code works, explaining the concepts it illustrates, and showing how to modify it to suit your needs. ... Extend Ruby using RubyGems, the Ruby package manager . ... Электронная библиотека попечительского совета мехмата МГУ , 2004-2016 . ...

Еще в разделе: (Показать все результаты (>11758) - lib.mexmat.ru/ )

• Onion F. - Essential ASP.NET With Examples in C# :: Электронная библиотека
• Buckland M. - Programming Game AI by Example :: Электронная библиотека
• Hirsch C. - Numerical Computation of Internal and External Flows :: Электронная

The essence of VES data processing may be shown on a flexure fold model (The central part of model is shown on fig.6). 2D modeling data for the flexure fold added with NSI were processed with the IPI-2D package, but at first example deep objects resistivities were made equal to surrounding to neglect their influence. ... Full model of flexure fold with NSI and deep objects . ... Comparison of apparent resistivity fields after filtering (a) and calculated without NSI (b) . ...

Еще в разделе: (Показать все результаты (>54) - geophys.geol.msu.ru/ )

• TES. Field example.
• TES tecnology. MSU.
• TRF_2d. Page 3.

... ucar.netcdf.AbstractNetcdf . ... public abstract class AbstractNetcdf . ... Create an empty instance to be populated with instances of some subclass of Variable. protected . ... Returns the set of attributes associated with this, also know as the "global" attributes. ... Returns the set of dimensions associated with this, the union of those used by each of the variables. protected void . ... Returns the set of dimensions associated with this, the union of those used by each of the variables. ...

Еще в разделе: (Показать все результаты (>155) - angel.cs.msu.su/ )

• : Class ConcreteIndexMap
• : Class AbstractLogger
• DataTableModel

. PQ web form . PQ reduced web form . TALSN GRIGKHRKH----PGGRGMAGGQHHHRTNLDKYHPGYFGKVGMRHFHLQRNHYWKPTINL DKLWSLVPEETREKYVAGNAPSDKAIVLDLLSLGYAKVLGKGRLPEVPIVVKARYVSKEA ERKIKEAGGVIELV .

Еще в разделе: (Показать все результаты (>17) - mouse.belozersky.msu.ru/ )

• Example of alignment
• Geometrical core
• PLANdbAffy: probe-level annotation database for Affymetrix expression

... Software . Laboratory of Mathematical Methods of Image Processing . ... Available options: -sigma - (mandatory) set blur parameter for the input image , range: 1.0 to 20.0 - power - set warping power , range: 0.0 to 5.0, default value is 1.0 -1d - apply one-dimensional algorithm (faster but lower quality) basicedges - detect basic edges - edges good for artifact analysis -scale - set scale parameter, range: 1.0 to 20.0, default value is 4.0 gaussblur - blur input ... warp.png . ...

Еще в разделе: (Показать все результаты (>54) - imaging.cmc.msu.ru/ )

Search: . ... About Trac . ... Previous Revision . Latest Revision . Next Revision . ... Revision Log . View revision: . ... Revision 57:2f62804e21fc , 517 bytes checked in by Daniil Alexeyevsky <me.dendik@тАж>, 5 years ago ( diff ) . Added example snake . ... snake Example . ... Rule 1: chase enemy tail . ... Rule 2: stick to walls . ... Powered by Trac 0.12.5 . ... Visit the Trac open source project at . http://trac.edgewall.org/ ...

Еще в разделе: (Показать все результаты (>1965) - kodomo.cmm.msu.ru/ )

• / (log) ? Python Battle
• WikiProcessors тАУ Tanchiki
• examples.zip тАУ Cyclyc Cell Automata

... Algorithm & . Format requirements . Contact us . Gallery of examples . SDPsite was applied to 124 families fron the Pfam database . ...

Еще в разделе: (Показать все результаты (>134) - bioinf.fbb.msu.ru/ )

• Alignment example
• User's guide
• SDPsite - Algorithm Format requirements

... Surface Acoustic Wave Propagation in the Presence of Strong External Field . ... The paper deals with the change of small amplitude surface acoustic wave (SAW) velocity in the presence of strong generalised field, for example the electric one [1]. ... As a result of computational procedure the sensitivity of SAW velocity to the external field is found. ... 1] Zelenka, J., Kosek, M.: Properties of surface acoustic wave devices under strong external fields. ...

Еще в разделе: (Показать все результаты (>125) - acs366.phys.msu.su/ )

... Поступление в лабораторию . ... Электронный журнал "Компьютерная графика и мультимедиа" . ... MSU Graphics & Media Lab (Video Group) . The filter is intended for recovering visual quality of video ripped from DVD (for example, when it contains 4 hours of video data), VideoCD or after decompressing by H.261, H.263, H.264, DivX, XviD, etc. The algorithm decreases blocking artifacts, significantly improving visual quality of video. ... Filter for VirtualDub MSU Deblocking (68 KB, ZIP) . ...

Еще в разделе: (Показать все результаты (>214) - graphics.cs.msu.ru/ )

• Removing of blocking effect from video | Graphics and Media Lab
• Hide information in video | Graphics and Media Lab
• Smart brightness and contrast correction | Лаборатория компьютерной графики и