Next: Activation Modes Up: Implementation Repository Previous: Forcing Activation of an . Assume we want to register the account server account_server2 from section 3.3.3 as a shared server. ... Recall that this server implemented the interface Account whose repository id is IDL:Account:1.0 . ... imr create Account shared /usr/bin/account_server2 IDL:Account:1.0 . ... imr create Account shared "rsh diamant /usr/bin/account_server2" \ IDL:Account:1.0 . ... account_client2.cc .. ...

Еще в разделе: (Показать все результаты (>375) - rtm-cs.sinp.msu.ru/ )

• Using a Servant Manager
• Activation Mode Shared
• Activation Mode Library

. To switch to another account from your current account: pwd /home/helper su projX Password: (password for account projX) whoami projX cd pwd /home/projX . The user helper switches to the account they have under the username projX and confirms this with the whoami command. They then use the cd command to place themselves in the home directory for the account they have switched to. They can now work with the files and directories in this account in the usual way.

Еще в разделе: (Показать все результаты (>507) - comet.sai.msu.ru/ )

• Example of logging in to another account
• Example of a .rhosts file
• Examples of opening a connection to a remote host

Modules | ... Apache HTTP Server Version 2.0 . ... The files in the src/modules/example directory under the Apache distribution directory tree are provided as an example to those that wish to write modules that use the Apache API. ... If you link it into your server, enable the "example-handler" handler for a location, and then browse to that location, you will see a display of some of the tracing the example module did as the various callbacks were made. ... Using the mod_example Module . ...

Еще в разделе: (Показать все результаты (>482) - itpm.msu.su/ )

• Definitions and Conventions
• mod_dav - Apache HTTP Server
• Another Example

Administrators can use this topic to register (i.e. create logins and user topics) for a group of people in one batch. ... Note that the new users are not notified that they have an account. ... First time use) Create new bulk registration topics (see Settings below). In the REGISTERTOPIC topic: create a table of new users. ... This table is a template for user data that will be written to the new user topics. ... User | ... You can write additional data to the new user topics. ...

Еще в разделе: (Показать все результаты (>41695) - dualopt1.cmm.msu.ru/ )

• %TOPICTITLE% (3 vs. 4) - TWiki
• BulkRegistration - TWiki - TWiki
• %TOPICTITLE% (60 vs. 61) - TWiki

This module illustrates many of the aspects of the Apache 1.2 API and, when used, demonstrates the manner in which module callbacks are triggered by the server. ... Source File: mod_example.c . ... The files in the src/modules/example directory under the Apache distribution directory tree are provided as an example to those that wish to write modules that use the Apache API. ... Example . ... Uncomment the "AddModule modules/example/mod_example" line near the bottom of the src/Configuration file. ...

Еще в разделе: (Показать все результаты (>102) - neptun.sai.msu.ru/ )

• Apache module mod_vhost_alias

Search: . ... About Trac . ... Browse Source . ... Previous Revision . Latest Revision . Next Revision . ... Revision Log . View revision: . ... Revision 100:b3fb9595fee7 , 6.1 KB checked in by darkhan, 5 years ago ( diff ) . Add examples.zip . HTML preview not available , since no preview renderer could handle it. ... Powered by Trac 0.12.5 . ... Visit the Trac open source project at . http://trac.edgewall.org/ ...

Еще в разделе: (Показать все результаты (>3613) - kodomo.cmm.msu.ru/ )

• example.snake in snakes тАУ Python Battle
• WikiRestructuredText тАУ Tanchiki

Электронная библиотека Попечительского совета . ... Marchal B. - XML by Example . ... Название: XML by Example . Автор: Marchal B. Аннотация: . XML by Example is a hands-on guide for those who already know the basics of HTML authoring but want a complete introduction to the exciting new world of XML. It lives up to its title, with plenty of examples of actual XML, HTML, JavaScript, and Java code. ... Электронная библиотека попечительского совета мехмата МГУ , 2004-2016 . ...

Еще в разделе: (Показать все результаты (>10983) - lib.mexmat.ru/ )

• Chu P.P. - FPGA Prototyping by Verilog Examples :: Электронная библиотека
• Журнал Probability and Statistics by Example :: Электронная библиотека
• Pap E. - Complex Analysis Through Examples And Exercises :: Электронная

... In this first example, we allow an object to fall onto a small radar unit . The resulting Time-Frequency distribution is shown as a contour plot in Fig. 8 (a). Figure: FIGURE GOES SOMEWHERE IN THIS GENERAL VICINITY . ... Its density plot appears as an image in Fig. ... The response has a very high peak, as evidenced from Fig. ...

Еще в разделе: (Показать все результаты (>1310) - crydee.sai.msu.ru/ )

• Long description for example showing how structurally overlapping cells are
• One example
• Image: Interesting example of building wall. No windows. Hmmm...

The essence of VES data processing may be shown on a flexure fold model (The central part of model is shown on fig.6). 2D modeling data for the flexure fold added with NSI were processed with the IPI-2D package, but at first example deep objects resistivities were made equal to surrounding to neglect their influence. ... Full model of flexure fold with NSI and deep objects . ... Comparison of apparent resistivity fields after filtering (a) and calculated without NSI (b) . ...

Еще в разделе: (Показать все результаты (>53) - geophys.geol.msu.ru/ )

• TES. Field example.
• TES tecnology. MSU.
• TRF_2d. Page 3.

... This module uses the functions of the ZZIPlib library by Guido Draheim to transparently read ZIP compressed archives and the files inside them. ... Zip Usage Example . php $zip = zip_open("/tmp/test2.zip"); if ($zip) { while ($zip_entry = zip_read($zip)) { echo "Name: " . ... n"; if (zip_entry_open($zip, $zip_entry, "r")) { echo "File Contents:\n"; $buf = zip_entry_read($zip_entry, zip_entry_filesize($zip_entry)); echo "$buf\n"; zip_entry_close($zip_entry); } echo "\n"; } zip_close($zip); } ?> ...

Еще в разделе: (Показать все результаты (>905) - oit.cmc.msu.ru/ )

• array_values
• Implementation of All Exported Functions
• Arrays

. PQ web form . PQ reduced web form . TALSN GRIGKHRKH----PGGRGMAGGQHHHRTNLDKYHPGYFGKVGMRHFHLQRNHYWKPTINL DKLWSLVPEETREKYVAGNAPSDKAIVLDLLSLGYAKVLGKGRLPEVPIVVKARYVSKEA ERKIKEAGGVIELV .

Еще в разделе: (Показать все результаты (>16) - mouse.belozersky.msu.ru/ )

• Example of alignment
• Geometrical core
• PLANdbAffy: probe-level annotation database for Affymetrix expression

Network Working Group D. Eastlake Request for Comments: 2606 A. Panitz BCP: 32 June 1999 Category: Best Current Practice Reserved Top Level DNS Names Status of this Memo This document specifies an Internet Best Current Practices for the Internet Community, and requests discussion and suggestions for improvements. ... Abstract To reduce the likelihood of conflict and confusion, a few top level domain names are reserved for use in private testing, as examples in documentation, and the like. ...

Еще в разделе: (Показать все результаты (>21878) - mirror.msu.net/ )

• http://mirror.msu.net/pub/gentoo-portage/dev-perl/Growl-GNTP/Growl-GNTP-0.200.0.ebuild
• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/pdfrfc/rfc2606.txt.pdf
• http://mirror.msu.net/pub/gentoo-portage/sci-mathematics/twelf/twelf-1.7.1.ebuild

... Algorithm & . Format requirements . Contact us . Gallery of examples . SDPsite was applied to 124 families fron the Pfam database . ...

Еще в разделе: (Показать все результаты (>136) - bioinf.fbb.msu.ru/ )

• Input Formats
• Alignment example
• User's guide

Implementation of vectorized finite-difference algorithms for solving boundary value problems of fluid and gas mechanics with MATLAB package" . Volkov K.N., Emelyanov V.N. An approach to organization of vectorized computations and implementation of finite-difference methods for solving boundary value problems of fluid and gas mechanics with MATLAB package is considered. ...

Еще в разделе: (Показать все результаты (>267) - num-meth.srcc.msu.ru/ )

• "Bayesian network prediction: algorithm and software implementation"
• "A general approach to the implementation of methods for the implicit surface
• "Parallel constrained global optimization for mathematical modeling of chemical

. Name . Last modified . Size . Description . Parent Directory . - . alpha/ . 2007-02-10 22:19 . - . alpha_and_beta/ . 2007-02-10 22:19 . - . beta/ . 2007-02-10 22:19 . - . Apache/2.4.12 (Debian) Server at kodomo.fbb.msu.ru Port 80

Еще в разделе: (Показать все результаты (>8244) - kodomo.fbb.msu.ru/ )

• cca: a308291203ea .hgtags
• cca: a308291203ea automata.py
• cca: a308291203ea state.py

... Corporate Social Policy as an Approach to Managing the Workforce: Some Examples from U. S. History, . ... Corporate social policy is one of the most significant subjects studied by business historians. To attract workers and maintain sound businesses some Russian entrepreneurs adopted paternalistic social welfare policies, described in several recently published works. ...

Еще в разделе: (Показать все результаты (>62) - hist.msu.ru/ )

... Query: E. coli K12 tRNA (valV, selC, asnV, leuT, argZ from EMBL entry U00096 ) . ... BLASTN (both) | ... Nhunt . ... BLASTN (optimal): 3.5 s . BLASTN (default): 0.8 s . ... Nhunt: 7 s The program Nhunt surpass all other tested programs in sensitivity. ... Nhunt BLASTN (optimal): 2.9 s . ... Nhunt: 3.7 s BLASTN with default parameters actually cannot find any significant homologues. ... Nhunt-3: 1.7 s BLASTN with default parameters actually cann't find any significant homologues. ...

Еще в разделе: (Показать все результаты (>13) - mouse.genebee.msu.ru/ )

• Align tool for DNA-protein complexes
• ConClus
• Nhunt

... 24 Ноя 2015 . кем editor | ... 19 Окт 2015 . ... 3 Дек 2015 . ... Декабрь 2015 . Ноябрь 2015 . Октябрь 2015 . Сентябрь 2015 . ... 2016 С Днем Победы! ... win 7 ultimate product key Windows 8 key windows 7 key win 7 key windows 7 pro product key win 7 pro product key windows 7 activation key windows 7 ultimate product key windows 7 ultimate serial key windows 7 key online win 7 ultimate key win 7 serial keys Win 7 ultimate ...

Еще в разделе: (Показать все результаты (>313) - elana.sinp.msu.ru/ )

• cheap moncler developed by examiners through their skills and expertise | С
• cheap moncler you may have the funds needed in another account such as a
• michael kors outlet uk which is accessible via the Internet as a Web server.

Alignment COG1325 . ... It is supported by 29 positions - that's written on the scheme. ... Such are positions number 5 ( leucine opposite isoleucine , valine and methyonine ), 30 ( glutamic acid opposite arginine , glycine and serine ), 51 ( threonine opposite alanine , phenylalanine and serine ), 55 ( phenylalanine opposite leucine , histidine and tyrosine ), 111 ( phenylalanine opposite isoleucine , leucine and valine ), 123 ( valine opposite isoleucine , ...

Еще в разделе: (Показать все результаты (>130) - monkey.belozersky.msu.ru/ )

• SDP home page
• SDPpred
• SCOP famyli:

. [Назад к основному тексту]

Еще в разделе: (Показать все результаты (>437) - chem.msu.ru/ )

• Entrance Examinations - Main Round
• Entrance Examinations - Preliminary Round
• Moscow University Chemistry Bulletin Vol. 44, No. 1, P. 72 (2003)