. PHP Manual . Prev . Next . (3.0.7 - 3.0.18 only, PHP 4 >= 4.0.0) pdf_place_image -- Places an image on the page . void pdf_place_image ( int pdf object, int image, float x, float y, float scale) . Place an image with the lower left corner at ( x , y ), and scale it. Prev . Home . Next . pdf_open_tiff . Up . pdf_place_pdi_page

Еще в разделе: (Показать все результаты (>3019) - oit.cmc.msu.ru/ )

• pdf_place_pdi_page
• preg_replace
• cpdf_place_inline_image

... Mon, 07 Feb 2011 21:46:43 +0300 . Daniil Alexeyevsky . Replaced all calls to obsolete Alignment.to_fasta() with Alignment.to_file() . ... Replaced all calls to obsolete Block.flush_left() with Block.flush("left") . ... Replaced calls to obsolete Alignment.from_file() with Alignment().append_file everywhere . Fri, 21 Jan 2011 15:00:23 +0300 . ... Wed, 12 Jan 2011 22:27:08 +0300 . ...

Еще в разделе: (Показать все результаты (>27300) - kodomo.fbb.msu.ru/ )

• allpy: utils/flush_left.py history
• allpy: test/usecase3.py history
• allpy: log

. аљб?аКаОаВаОаДб?б?аВаО аПаОаЛб?аЗаОаВаАб?аЕаЛб? Gnumeric . Prev . Next . REPLACE -- . REPLACE(old,start,num,new) . REPLACE б?б?аВб?а?аПа?аПб?а? @old c @num а?б?б?б?б?б?аПб?б? аВаПб?б?б?б?б?б?а?б?б? б?аП @new б?аПа?б?б?аПа? а? @start. аМа?аП а?а?б?аЗа?б?а? а?б?б?б?б?а?а?б?б?аП а? Excel. REPLACE("testing",2,3,"*****") а?аПб?б?а?б?а?а?а? "t*****ing". MID , SEARCH , SUBSTITUTE , TRIM . Prev . Home . Next . RECEIVED . Up . REPT

Еще в разделе: (Показать все результаты (>1912) - uneex.lorien.cs.msu.su/ )

• HEX2OCT
• DEC2OCT
• OCT2HEX

grdedit - Modifying the header in a 2-D grdfile grdedit grdfile [ -A ] [ -D xunit / yunit / zunit / scale / offset / title / remark ] [ -R west / east / south / north [ r ] ] [ -S ] grdedit reads the header information in a binary 2-D grdfile and replaces the information with values provided on the command line [if any]. ... Older gridfiles (i.e., created prior to GMT 3.1) often had excessive slop in x _ inc , y _ inc and an adjustment is necessary. Newer files are created correctly. ...

Еще в разделе: (Показать все результаты (>470) - xray.sai.msu.ru/ )

• http://xray.sai.msu.ru/~ivan/gmt/man/psimage.html
• http://xray.sai.msu.ru/~ivan/gmt/man/psscale.html
• http://xray.sai.msu.ru/~ivan/gmt/man/grdvector.html

Welcome , Registration , and other StartingPoints ; TWiki history & Wiki style; All the docs.. ... Education . ... VarSPACEOUT . Inserts spaces after lower case letters that are followed by a digit or a capital letter, and after digits that are followed by a capital letter. ... Syntax: %SPACEOUT{ "%TOPIC%" }% . Expands to: Var SPACEOUT . ... separator . ... Copyright by the contributing authors. ... Note: Please contribute updates to this topic on TWiki.org at TWiki:TWiki.VarSPACEOUT . ...

Еще в разделе: (Показать все результаты (>39086) - dualopt1.cmm.msu.ru/ )

• %TOPICTITLE% (1 vs. 2) - TWiki
• VarSPACEOUT - TWiki - TWiki - (printable)
• %TOPICTITLE% (3 vs. 4) - TWiki

You are here: Foswiki > System Web > Macros > VarSPACEOUT (19 Sep 2010, ProjectContributor ) E dit A ttach . ... Syntax: %SPACEOUT{ "%TOPIC%" }% . ... separator . The separator to put between words e.g. %SPACEOUT{"DogsCatsBudgies" separator=", "}% -> Dogs, Cats, Budgies . ... To SPACEOUT a WikiWord but preserve the link use "double bracket" format. ... Topic revision: r1 - 19 Sep 2010, ProjectContributor . System . ... Users . ... Admin Maintenance . ... Copyright by the contributing authors. ...

Еще в разделе: (Показать все результаты (>10550) - wiki.cmc.msu.ru/ )

• JQueryButton < System < Foswiki

SAI, graduates year 1982. ... Note: when just a 7-digit phone number is shown, it refers to a phone located in Moscow (international access 007-495). "+" in front of a number means that you must dial an international access code first (or just press "+" on your mobile phone keypad). ... 939-1672(work); . ... Ataev Sasha . 1-(703)-536-8881(home) (USA); . ... Bychkov Sergey . ... 1-(410)-740-8205(home), +1-(301)-286-2150(work) (USA); . ... 1-(412)-767-0332(home), +1-(412)-608-9339(mobile) (USA); . ...

Еще в разделе: (Показать все результаты (>48) - uranus.sai.msu.ru/ )

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>121) - www.genebee.msu.ru/ )

• AliGraf - GeneBee Graphical Alignment Help
• FASTA format description

... Your assignment is to break into their headquarters and get it. ... Play Information * Episode and Level # : E1M1 (with apologies to ID for it being in E1) Single Player : Yes Cooperative 2-4 Player : No Deathmatch 2-4 Player : No Difficulty Settings : Yes, but setting 4 (Ultra Violence) is best New Sounds : No New Graphics : No Demos Replaced : None * Construction * Base : New level from scratch Build Time : hours, days, weeks, months (a long time) Editor(s) used : DEU and BSP, until they failed. ...

Еще в разделе: (Показать все результаты (>29523) - crydee.sai.msu.ru/ )

• Long description for example showing inside vs. outside list marker
• Long description for example with clipped overflow
• Album: 08 09 Lower pond

... A Black Hole in M87's Center? ... 5.03.1996 . ... Credit: H. Ford ( JHU and StScI ), R. Harms ( ARC ), NASA , HST , FOS Explanation: The center of nearby giant galaxy M87 is a dense and violent place. In this 1994 photograph by the Hubble Space Telescope , a disk of hot gas was found to be orbiting at the center of this massive elliptical galaxy . ... Publications with keywords: black hole . ... Jumbled Galaxy Centaurus A . ... The Center of Centaurus A . ... Black Holes in Galactic Centers . ...

Еще в разделе: (Показать все результаты (>13233) - www.astronet.ru/ )

• Journal "Peremennye Zvezdy"
• Астронет > A Black Hole in M87's Center?
• A Black Hole in M87?

... The SUB and SUP elements are used for subscripts and superscripts respectively, and are preferably rendered in reduced font. ... Some times you will want to place superscripts to the left of a term. ... For instance: X<sub align=right>a</sub> <sup align=left>b</sup>Y X<sub align=right>a</sub>Y<sup align=left>b</sup> b both render to X Y a while X<sub align=right>a</sub><sup align=left>b</sup>Y b renders to X Y a . ... The ID, LANG and CLASS attributes for SUB and SUP are not used within MATH...

Еще в разделе: (Показать все результаты (>264) - comet.sai.msu.ru/ )

• The Shell
• Examples of replacing text
• Query replace

This is the complete list of member functions and enum types for QString , including all inherited members. QString . append . assign . ... operator!= . ... Copyright © 1998 Troll Tech . ... Qt version 1.40 ...

Еще в разделе: (Показать все результаты (>671) - rtm-cs.sinp.msu.ru/ )

• Qt Toolkit - QMultiLineEdit Class
• Qt Toolkit - QToolBar Class
• Qt Toolkit - QIntDict Class

Introduction to Botany BIOL 154 ­ Laboratory Manual Microscopy: 1. eyepieces or oculars lenses that magnify 10 times 2. objective lenses low/high-power lenses to be clicked in place by rotation, the magnification is indicated on the side of each lens 3. stage with clamps and knobs for holding and moving the slides 4. condenser lens system below the stage to concentrate light in the plane of the object, fixed in ... Always begin with the lowest-power objective in place. ...

Еще в разделе: (Показать все результаты (>433) - herba.msu.ru/ )

• http://herba.msu.ru/shipunov/school/biol_250/2010_2011/microscopy_manual.pdf
• Wakehurst Place, April 2003
• Materials of A. Shipunov

... ALTER FULLTEXT MAPPING -- change token binding with FTS dictionaries . ... ALTER FULLTEXT MAPPING change binding of token of tokentypename or create one if binding doesn't exists. cfgname . ... ALTER FULLTEXT MAPPING ON testcfg FOR lword WITH simple; ALTER FULLTEXT MAPPING =# ALTER FULLTEXT MAPPING ON testcfg FOR lhword WITH simple,en_stem; ALTER FULLTEXT MAPPING =# \dF+ testcfg Configuration 'testcfg' Parser name: 'default' Locale: 'testlocale' Token | ... simple . CREATE FULLTEXT MAPPING . ...

Еще в разделе: (Показать все результаты (>4165) - www.sai.msu.su/ )

• Guru's TIMPS: Instant Backdrops
• APOD: 2013 December 11 - The Coldest Place on Earth
• Zen: tp search

Copyright 1999-2014 Gentoo Foundation # Distributed under the terms of the GNU General Public License v2 # $Id$ EAPI=5 inherit toolchain-funcs DESCRIPTION= Simulate up to 9 PCs in place of VMware boxes in a Dynamips network HOMEPAGE= http://vpcs.sourceforge.net SRC_URI= mirror://sourceforge ...

Еще в разделе: (Показать все результаты (>46325) - mirror.msu.net/ )

• http://mirror.msu.net/pub/gentoo-portage/eclass/versionator.eclass
• http://mirror.msu.net/pub/gentoo-portage/app-i18n/man-pages-ru/man-pages-ru-3.71.2209.1992.20140911.ebuild
• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/pdfrfc/rfc6474.txt.pdf

... unary minus) .my.cnf file , .my.cnf file , .my.cnf file , .my.cnf file , .my.cnf file , .my.cnf file , .my.cnf file .mysql_history file .pid (process ID) file . ... Arithmetic functions . ... Bit functions . ... Control flow functions . ... CREATE FUNCTION . CREATE INDEX . ... Date and time functions . ... DBI->{type} . ... DROP FUNCTION . DROP INDEX . ... MYSQL C type . ... MYSQL_FIELD C type . ... MYSQL_FIELD_OFFSET C type . ... MYSQL_RES C type . MYSQL_ROW C type . ... REVERSE() . ...

Еще в разделе: (Показать все результаты (>387) - itpm.msu.su/ )

• mod_disk_cache - Apache HTTP Server
• mod_file_cache - Apache HTTP Server
• MySQL Reference Manual for version 3.23.10-alpha. - H Description of MySQL

The Department of Talented Youth Affairs and Professional Orientation . ... The first All-Russian geographical dictation took place on November 1. The theme of the dictationљwas ?My country ? ... The dictation consisted of three blocks. ... The dictation will assess the level of geographical knowledge of all citizens of our country and attract attention to the problem of geographic literacy. ... 2016 - The Department of Talented Youth Affairs and Professional Orientation ...

Еще в разделе: (Показать все результаты (>53) - talant.msu.ru/ )

• Russia took first place at the World Championships in Collegiate Programming
• Moscow State University took 3rd place in the ranking of universities among the
• III Championship in an innovative educational project Cansat in Russia | The

... The paper applies the method of integrated language description to the study of `truth' concepts in Russian to explain a hitherto unaccounted for polysemy of the Russian word pravda Keywords: linguistics, semantics There has been abundant research on the Russian concept of `truth' [Levin 1994, Arutiunova 1995, Bulygina & Shmelev 1997, Wierzbicka 2002], mainly focused on the distinctions between two kinds of `truth' found in Russian - pravda `factual truth' (as in - Ja tam ne byl. ...

Еще в разделе: (Показать все результаты (>316) - www.philol.msu.ru/ )

• http://www.philol.msu.ru/~otipl/new/main/courses/Intro_appl/Instrukcia_dz_po_wordnet.doc

... Next: Column Selection Up: Cursor modes Previous: Drawing Curves Contents Index . Line Selection Mode allows to select sections across the scanning line. Press the left Button of the Mouse on the line of interest - the line will be selected and the section will appear in the window. ... The scan lines are counted beginning from the lower one. ... Next: Column Selection Up: Cursor modes Previous: Drawing Curves Contents Index Filonov 2005-02-04 ...

Еще в разделе: (Показать все результаты (>113) - www.spm.genebee.msu.ru/ )

• Moving the scanning window
• Column Selection
• Files Quick Viewing

... About lab . ... Online Journal "Computer graphics and multimedia" (in russian) . ... The Microsoft Machine Learning and Intelligence School will take place in Saint Petersburg, Russia, from July 29 to August 5, 2015. ... Qualified candidates should complete their applications by March 31, 2015. Acceptance decisions will be made around May 15, 2015. ...

Еще в разделе: (Показать все результаты (>186) - graphics.cs.msu.ru/ )

• DOC3d: A 3d Documentations system for programming languages | Graphics and
• DOC3d: A 3d Documentations system for programming languages | Лаборатория
• GML Texturizer Tutorial | Лаборатория компьютерной графики и мультимедиа