... To go through each file in the current directory and compare it with the same filename in another directory: #!/bin/sh # compare files to same file in directory "old" for i in * do echo $i: cmp $i old/$i echo done . ... Some examples of command substitution in for loops: #!/bin/sh # do something for all files in current # directory according to time modified for i in `ls -t` do ... done # do something for all non-fred files. for i in `cat filelist | ...

Еще в разделе: (Показать все результаты (>481) - comet.sai.msu.ru/ )

• Example of using the break and continue statements
• Example of using the case statement
• Examples of using the while and until statements

... OCINewCursor() allocates a new statement handle on the specified connection. ... php // suppose your stored procedure info.output returns a ref cursor in :data $conn = OCILogon("scott","tiger"); $curs = OCINewCursor($conn); $stmt = OCIParse($conn,"begin info.output(:data); end;"); ocibindbyname($stmt,"data",&$curs,-1,OCI_B_CURSOR); ociexecute($stmt); ociexecute($curs); while (OCIFetchInto($curs,&$data)) { var_dump($data); } OCIFreeStatement($stmt); OCIFreeCursor($curs); OCILogoff($conn); ?> ...

Еще в разделе: (Показать все результаты (>454) - oit.cmc.msu.ru/ )

• switch
• include
• foreach

... Changed: . The %IF% construct gives TWiki the power to include content in topics based on the value of simple expressions. ... In the example above, if CONDITION evaluates to TRUE, then THEN will be included in the topic; otherwise ELSE will be included. ... The standard FormatTokens can be used in the THEN and ELSE parameters when you need to delay evaluation of (for example) a TWiki variable. ... atom bop basexpr ; uop ::= 'context' | ... True if the current context is set (see below) . ...

Еще в разделе: (Показать все результаты (>39815) - dualopt1.cmm.msu.ru/ )

• IfStatements - TWiki - TWiki - (printable)
• IfStatements - TWiki - TWiki

As conditional or control statements you have IF in many variants (but essentially not changed from Fortran 77), DO (with some new variants) and the completely new statement CASE . The DO- loop should now be ended with the statement END DO and we no longer need any statement number. In addition, we can use the statement EXIT to jump out of the DO -loop and CYCLE in order to go to the next iteration of the present DO -loop. ... all negative numbers WRITE (*,*) 'Negative number' CASE (0) ! ...

Еще в разделе: (Показать все результаты (>831) - crydee.sai.msu.ru/ )

• Specifications
• Fortran 95
• Generic routines

Электронная библиотека Попечительского совета . ... Kline K.E. - SQL in a Nutshell . ... Название: SQL in a Nutshell . Автор: Kline K.E. Аннотация: . This essential desktop reference drills down and documents every SQL command and how to use it in both commercial (Oracle, DB2, and Microsoft SQL Server) and open source implementations (PostgreSQL, and MySQL). ... associating SQL with . ... ATN2 function (SQL Server) . ... Электронная библиотека попечительского совета мехмата МГУ , 2004-2016 . ...

Еще в разделе: (Показать все результаты (>8695) - lib.mexmat.ru/ )

• Liberty J. - Learning Visual Basic .NET :: Электронная библиотека
• Organick E.I., Forsythe A.I., Plummer R.P. - Programming Language Structures ::
• Mayer F., MacMillan K., Caplan D. - SELinux by Example: Using Security Enhanced

Network Working Group D. Eastlake Request for Comments: 2606 A. Panitz BCP: 32 June 1999 Category: Best Current Practice Reserved Top Level DNS Names Status of this Memo This document specifies an Internet Best Current Practices for the Internet Community, and requests discussion and suggestions for improvements. ... Abstract To reduce the likelihood of conflict and confusion, a few top level domain names are reserved for use in private testing, as examples in documentation, and the like. ...

Еще в разделе: (Показать все результаты (>20042) - mirror.msu.net/ )

• FYI: 1

This page could be summarized with the statement: don't require Apache to use DNS for any parsing of the configuration files . ... In order for Apache to function properly it absolutely needs to have two pieces of information about each virtual host: the ServerName and at least one IP address that the server responds to. ... use IP addresses in Listen . ... In any event it doesn't seem possible to reliably boot a virtual-hosted web server when DNS has failed unless IP addresses are used. ...

Еще в разделе: (Показать все результаты (>96) - neptun.sai.msu.ru/ )

• Apache module mod_example
• Apache module mod_vhost_alias
• Apache's Handler Use

... Apache HTTP Server Version 2.0 . Apache > HTTP Server > Documentation > Version 2.0 > И?Ет . ... example_module . ... РЬ Й?М-ДТ ОЦЦФФЕ Р?М-Й? 2.0 Й?Р?ПЕМ- К?АцЕШ ГЛПыРЛ ДуАэ РжС? ... ОЦЦФФЕ ЙшЦ?КЛ src/modules/example Е?ЗКХфИ? ... И?ЕтРЛ РлМКЧЯЗСДТ ЛчЖ?ЕщРЛ ЕНБтР?Чб ПЙС?Дй. mod_example.c ДТ И?Еч ФнЙщ(callback) БИСЖПЭ Ш?Ут Й?ЙРЛ МГИэЧЯДТ ЦФРЯРЬДй. ... Example . ... mod_example И?Ет ЛчПыЧЯБт . ... src/Configuration ЦФРЯ ОЦЗЕ КЮКаПЕ РжДТ "AddModule modules/example/mod_example" СйРЧ СжМ?УГИ?И? О?ОиДй. ...

Еще в разделе: (Показать все результаты (>452) - itpm.msu.su/ )

• Issues Regarding DNS and Apache - Apache HTTP Server
• MySQL Reference Manual for version 3.23.10-alpha. - 15 Adding new procedures to
• Another Example

The essence of VES data processing may be shown on a flexure fold model (The central part of model is shown on fig.6). 2D modeling data for the flexure fold added with NSI were processed with the IPI-2D package, but at first example deep objects resistivities were made equal to surrounding to neglect their influence. ... Full model of flexure fold with NSI and deep objects . ... Comparison of apparent resistivity fields after filtering (a) and calculated without NSI (b) . ...

Еще в разделе: (Показать все результаты (>55) - geophys.geol.msu.ru/ )

• TES. Field example.
• TES tecnology. MSU.
• TRF_2d. Page 3.

Zero-range potentials as an algorithm for solution of quantum scattering problems" . Sokolovsky V.V., Popov Yu.V., Gusev A.A., Vinitsky S.I. It is shown that zero-range potentials can successfully be used to construct a numerical algorithm for the solution of 1D scattering problems. ... The class of separable potentials close to the zero-range potentials is proposed, which allows one to solve 3D scattering problems and, at the same time, to keep the wave function confined. ...

Еще в разделе: (Показать все результаты (>160) - num-meth.srcc.msu.ru/ )

• Publication Ethics and Publication Malpractice Statement
• "A three-dimensional family of seven-step Runge-Kutta methods of order six"

. PQ web form . PQ reduced web form . TALSN GRIGKHRKH----PGGRGMAGGQHHHRTNLDKYHPGYFGKVGMRHFHLQRNHYWKPTINL DKLWSLVPEETREKYVAGNAPSDKAIVLDLLSLGYAKVLGKGRLPEVPIVVKARYVSKEA ERKIKEAGGVIELV .

Еще в разделе: (Показать все результаты (>16) - mouse.belozersky.msu.ru/ )

• Example of alignment
• Geometrical core
• PLANdbAffy: probe-level annotation database for Affymetrix expression

Search: . ... About Trac . ... Previous Revision . Latest Revision . Next Revision . ... Revision Log . View revision: . ... Revision 57:2f62804e21fc , 517 bytes checked in by Daniil Alexeyevsky <me.dendik@тАж>, 5 years ago ( diff ) . Added example snake . ... snake Example . ... Rule 1: chase enemy tail . ... Rule 2: stick to walls . ... Powered by Trac 0.12.5 . ... Visit the Trac open source project at . http://trac.edgewall.org/ ...

Еще в разделе: (Показать все результаты (>1200) - kodomo.cmm.msu.ru/ )

• examples.zip тАУ Cyclyc Cell Automata
• WikiRestructuredText тАУ Tanchiki

... 2015 . ... Ph.D., Lecturer, Faculty of Philosophy, Lomonosov Moscow State University; Assistant Professor, Sholokhov Moscow State Humanitarian University, Moscow, Russian Federation. ... In this article we analyze the experience of crisis communications in the United States after the terrorist attacks of September 11, 2001 and in the UK after the terrorist attacks of July 7, 2005, including the apparent weaknesses in government statements, as well as public reaction to those statements. ...

Еще в разделе: (Показать все результаты (>84) - ee-journal.spa.msu.ru/ )

... Algorithm & . Format requirements . Contact us . Gallery of examples . SDPsite was applied to 124 families fron the Pfam database . ...

Еще в разделе: (Показать все результаты (>137) - bioinf.fbb.msu.ru/ )

• Alignment example
• SDPsite - Algorithm Format requirements
• User's guide

. Name . Last modified . Size . Description . Parent Directory . - . alpha/ . 2007-02-10 22:19 . - . alpha_and_beta/ . 2007-02-10 22:19 . - . beta/ . 2007-02-10 22:19 . - . Apache/2.4.12 (Debian) Server at kodomo.fbb.msu.ru Port 80

Еще в разделе: (Показать все результаты (>5931) - kodomo.fbb.msu.ru/ )

• snake: 954cc2774637 snakes/example.snake
• cca: a308291203ea .hgtags
• cca: a308291203ea state.py

. ? mfs = 0.7 cm . ? hsfa = 0.8 cm . D sun_slit = F ? (2?) [rad] [cm] . (F mfs = 13500 mm, F hsfa = 35000 mm) . A procedure for calibrating fits images from Ondrejov Multichannel Flare Spectrograph .

Еще в разделе: (Показать все результаты (>100) - lnfm1.sai.msu.ru/ )

• FITShdr: INSTALL
• IDL programs
• Manpage of FITSHDR

... Corporate Social Policy as an Approach to Managing the Workforce: Some Examples from U. S. History, . ... Corporate social policy is one of the most significant subjects studied by business historians. To attract workers and maintain sound businesses some Russian entrepreneurs adopted paternalistic social welfare policies, described in several recently published works. ...

Еще в разделе: (Показать все результаты (>48) - hist.msu.ru/ )

... Query: E. coli K12 tRNA (valV, selC, asnV, leuT, argZ from EMBL entry U00096 ) . ... BLASTN (both) | ... Nhunt . ... BLASTN (optimal): 3.5 s . BLASTN (default): 0.8 s . ... Nhunt: 7 s The program Nhunt surpass all other tested programs in sensitivity. ... Nhunt BLASTN (optimal): 2.9 s . ... Nhunt: 3.7 s BLASTN with default parameters actually cannot find any significant homologues. ... Nhunt-3: 1.7 s BLASTN with default parameters actually cann't find any significant homologues. ...

Еще в разделе: (Показать все результаты (>13) - mouse.genebee.msu.ru/ )

• Align tool for DNA-protein complexes
• ConClus
• Nhunt

Alignment COG1325 . ... It is supported by 29 positions - that's written on the scheme. ... Such are positions number 5 ( leucine opposite isoleucine , valine and methyonine ), 30 ( glutamic acid opposite arginine , glycine and serine ), 51 ( threonine opposite alanine , phenylalanine and serine ), 55 ( phenylalanine opposite leucine , histidine and tyrosine ), 111 ( phenylalanine opposite isoleucine , leucine and valine ), 123 ( valine opposite isoleucine , ...

Еще в разделе: (Показать все результаты (>318) - monkey.belozersky.msu.ru/ )

• SDP home page
• SDPpred
• SCOP famyli:

. [Назад к основному тексту]

Еще в разделе: (Показать все результаты (>245) - chem.msu.ru/ )

• Entrance Examinations - Preliminary Round
• Moscow University Chemistry Bulletin Vol. 48, No. 4, P. 265 (2007)
• Moscow University Chemistry Bulletin Vol. 47, No. 4, P. 257 (2006)