. Album : asv-album :: Travels to distant places and countries :: 1998/06 Nauchny, Katsively (Crimea, Ukraine) :: Кацивели . Up . << Prev . On the road to Simeiz; note small dome on the ridge -- another observatory . Next >> . Album created by album tool a script by David on Tue Jun 23 14:46:48 2015 .

Еще в разделе: (Показать все результаты (>6767) - crydee.sai.msu.ru/ )

• XFree86/OS2 Download Page
• Full Throttle Walkthrough (ver. 1.1)
• Full Throttle Walkthru

... name="TWikiVariables" . ... Generates the full URL of a TWikiDocGraphics image, which TWiki renders as an image. The related %ICON{"name"}% generates the full HTML img tag. Specify image name or full filename (see ICON for details on filenames.) ... Syntax: %ICONURL{"name"}% . ... ICONURL{"arrowbright"}% returns http://dualopt1.cmm.msu.ru/pub/TWiki/TWikiDocGraphics/arrowbright.gif . ICONURL{"novel.pdf"}% returns http://dualopt1.cmm.msu.ru/pub/TWiki/TWikiDocGraphics/pdf.gif . ...

Еще в разделе: (Показать все результаты (>38788) - dualopt1.cmm.msu.ru/ )

• VarICONURL - TWiki - TWiki
• VarICONURL - TWiki - TWiki - (printable)
• %TOPICTITLE% ( vs. 1) - TWiki

RSUA_ECOLI P0AA43 RecName: Full=Ribosomal small subunit pseudouridine synthase A; EC=5.4.99.- ... AltName: Full=rRNA-uridine isomerase E; AltName: Full=rRNA pseudouridylate synthase E; MLVLLNKPYGVLSQFSDRSQPPKRTLAEFGLPPDVYAAGRLDHDSEGLLVLTDDGALAHR LTDPRHKQPKTYWVQVEGAPQAEHLQALRDGVALNDGPTRPAQVRMLDPAPQLWPRDPPV RVRKTVPDAWLELQITEGRNRQVRRMTAAVGLPTLRLVRVAIGDWRLDALAPGQWRAEAT TNARPSRSRR >Y361_SYNY3 Q55578 RecName: Full=Uncharacterized RNA pseudouridine synthase slr0361; EC=5.4.99.- ...

Еще в разделе: (Показать все результаты (>3331) - kodomo.cmm.msu.ru/ )

• http://kodomo.cmm.msu.ru/~maravilla/term2/myproteins_aligned.fasta
• / (log) ? Python Battle
• life (log) тАУ Cyclyc Cell Automata

Электронная библиотека Попечительского совета . ... Queinnec C. - Lisp in Small Pieces . ... Название: Lisp in Small Pieces . Автор: Queinnec C. Аннотация: . Intended for graduate students, advanced undergrads, and computer programmers with prior knowledge of Lisp or Scheme, and recursive programs. ... in Common Lisp 37 . ... Common Lisp, lexical escapes in 76 . ... Электронная библиотека попечительского совета мехмата МГУ , 2004-2016 . ...

Еще в разделе: (Показать все результаты (>8340) - lib.mexmat.ru/ )

• Ammari H., Hyeonbae Kang - Reconstruction of Small Inhomogeneities from
• Yeadon W. - Handbook of small electric motors :: Электронная библиотека
• Leboff G. - Sales Therapy. Effective Selling for the Small Business Owner ::

. Главная . О филаментах . Публикации . Статьи . Лаборатория . Организация . Сайты . Choose a paper: . Time-dependent_small-scale_self-focusing_of_femtosecond_laser_pulse.pdf . Back

Еще в разделе: (Показать все результаты (>50) - ilc.phys.msu.ru/ )

... Backups . ... The simple backup method outlined in the previous section is often quite adequate for personal use or small sites. For more heavy duty use, multilevel backups are more appropriate. The simple method has two backup levels: full and incremental backups. ... A full backup would be level 0, and the different levels of incremental backups levels 1, 2, 3, etc. ... Figure 10-1 shows which backup level is used each day, and which backups can be restored from at the end of the month. ...

Еще в разделе: (Показать все результаты (>316) - itpm.msu.su/ )

• Another Example
• CD-ROM's

. Published since 1829 . Editor in Chief: A.S. Severtsov . Editorial Board :V.N. Pavlov (Assistant Editor), Yu.A. Dubrovsky, F.Ya. Dzerzhinsky, R.D. Zhantiev, V.G. Krivenko, M.V. Mina, E.N. Mirzoyan, O. P.Poltaruha, D.D.Sokoloff, V.G. Onipchenko, A.V. Sviridov, G.N. Simkin, M.V. Nilova (Secretary), P.S. Tomkovich.

Еще в разделе: (Показать все результаты (>279) - herba.msu.ru/ )

• Plant evolution on the small islands of the Russian White Sea
• A study of freshwater invertebrates of the environs of Podpakhta Inlet and

... Three-dimensional structure of alpha-crystallin domain dimers of human small heat shock proteins HSPB1 and HSPB6. ... Small heat shock proteins (sHSPs) are a family of evolutionary conserved ATP-independent chaperones. ... To further analyze the structure of ACD dimers, we have employed a combination of X-ray crystallography and solution small-angle X-ray scattering (SAXS) to study the ACD-containing fragments of human HSPB1 (HSP27) and HSPB6 (HSP20). ...

Еще в разделе: (Показать все результаты (>59) - biochem.bio.msu.ru/ )

• Molecular structure and dynamics of the dimeric human small heat shock protein
• Small heat shock protein Hsp27 prevents heat-induced aggregation of F-actin by
• Heterooligomeric complexes formed by human small heat shock proteins HspB1

... Fault tolerance of small-world regular and stochastic interconnection networks" . Demichev A.P., Ilyin V.A., Kryukov A.P., and Polyakov S.P. The fault tolerance of the most important properties of stochastic and regular (deterministic) small-world interconnection networks are studied. ... Demichev A.P. тАУ Skobeltsyn Institute of Nuclear Physics, Lomonosov Moscow State University; Leninskie Gory, Moscow, 119991, Russia; Ph.D., Senior Scientist, e-mail: demichev@theory.sinp.msu.ru . ...

Еще в разделе: (Показать все результаты (>197) - num-meth.srcc.msu.ru/ )

• A method of redundant constraint elimination in the problem of body recovery
• "A small-mode approximation in the stellar dynamo problem"
• Regularized inversion of full tensor magnetic gradient data

. Using the C, Korn, TC or BASH shell enables you to substitute the ~ (tilde) character in place of the full pathname to your own or another user's home directory. For example, the command cd ~helper . changes your working directory to the home directory of the user "helper". This is very useful if you have access permission to a directory in another users home directory but don't know the full pathname to it.

Еще в разделе: (Показать все результаты (>227) - comet.sai.msu.ru/ )

• Making a tarfile smaller
• Changing to another directory
• Font Style Elements

... Главная -> Фильмы -> A Small Circle of Friends . ... Фильмы . ... A Small Circle of Friends . США 1980 . ... Karen Allen . ... John Friedrich . ... David Hollander . ... John Peters . ... William N. Chamberlain . ... William J. Sahlein . ... David Tomaras . ...

Еще в разделе: (Показать все результаты (>1111) - kinfo.ru/ )

• Small Gods - Фильмы - Kinfo.ru
• Two Small Bodies - Фильмы - Kinfo.ru
• Small Engine Repair - Фильмы - Kinfo.ru

Выберите категорию обращения: Общие вопросы Отчеты Рейтинги Диссертационные советы Конкурсы Ввод данных Структура организаций Пользователи Проблемы с регистрацией\входом в систему . ... Войти в систему . ... Gokhman Vladimir E. , Spencer Johnston J. , Small Chiyedza , Rajwani Roma , Hanrahan Shawn J. , Govind Shubha . ...

Еще в разделе: (Показать все результаты (>1161) - istina.msu.ru/ )

• Small - журнал | ИСТИНА - Интеллектуальная Система Тематического Исследования
• Journal of Small Business Management - журнал | ИСТИНА - Интеллектуальная
• International Journal of Entrepreneurship and Small Business - журнал | ИСТИНА

Series on Stability, Vibration and Control of Systems, Series A - Vol. ... MULTIPARAMETER STABILITY THEORY WITH MECHANICAL APPLICATIONS . ... This book deals with fundamental problems, concepts, and methods of multiparameter stability theory with applications in mechanics. ... Introduction to Stability Theory . ... Read Full Review . ... Since Bolotin's pioneering book on nonconservation problems on the theory of elastic stability, not many books appeared at such a high level, such as this one. ...

Еще в разделе: (Показать все результаты (>30) - mailybaev.imec.msu.ru/ )

... It was found that various organic compounds and inorganic salts added in small concentrations to aqueous solutions increase the quantum yields of photochemical chain ion- radical substitution reactions of a halogen by sulpho group in halogenated naphthylamine (4- chloro-1-naphthylamine) and hydroxynaphthalenes (1-bromo-2-hydroxynaphthalene and 4- chloro-2-hydroxynaphthalene). ...

Еще в разделе: (Показать все результаты (>337) - chem.msu.ru/ )

• Time-of-flight mass spectroscopy detection of new elemental and mixed small
• Ivan Sorokin
• Moscow University Chemistry Bulletin Vol. 56, No. 3, P. 147 (2015)

Copyright 1999-2013 Gentoo Foundation # Distributed under the terms of the GNU General Public License v2 # $Id$ GENQMAIL_PV=20080406 inherit eutils qmail DESCRIPTION= a small null client that forwards mail via QMQP to a full qmail server HOMEPAGE= http :// netqmail .org/ http ://cr.yp.to/ qmail /mini.html http :// qmail .org/ SRC_URI= mirror:// qmail / netqmail -${PV} ...

Еще в разделе: (Показать все результаты (>17286) - mirror.msu.net/ )

• http://mirror.msu.net/pub/gentoo-portage/mail-mta/mini-qmail/mini-qmail-1.05.ebuild
• http://mirror.msu.net/pub/gentoo-portage/mail-mta/mini-qmail/mini-qmail-1.05-r1.ebuild
• http://mirror.msu.net/pub/slackware-current/slackware/ap/jed-0.99_19-i486-2.txt

... Ph.D., associate professor, Penza Branch, Russian State University of Innovative Technologies and Business. ... Тhe article argues that the efficiency of state support system for small innovative business is low today. ... Implementation of this models by small innovative business would allow estimating influence of qualitative factors on the productivity of this system as a whole. ... Small innovative enterprises, state support, efficiency increase, evaluation method. ... Public Administrarion". ...

Еще в разделе: (Показать все результаты (>515) - ee-journal.spa.msu.ru/ )

Storing and accessing the largest astronomical catalogues with the SAI CAS project S. Koposov1,2,3, O. Bartunov2, S. Karpov4 et al2. ... Why we want to build our own Catalogue Access Service The requirements for our CAS system The importance of the Database for the CAS (PostgreSQL & Q3C) The technical realization of CAS What has been already done Example of work TODO Storing and Accessing Astronomical Catalogues Existing projects CDS OpenSkyQuery CASjobs with SDSS They are all really great! ...

Еще в разделе: (Показать все результаты (>203) - lnfm1.sai.msu.ru/ )

• Photos from the trip to Germany, Austria and Italy and from the EURO-VO

... Group Properties of Systems of Nonlinear Diffusion Equations with a Small Parameter . ... In this paper attention will focus on system of (1+1) nonlinear diffusion equations with a small parameter. ... of coupled diffusion equation in (1+1), (1+2) and   (1+3) dimentional cases as well as systems with source terms were analysed. ...

Еще в разделе: (Показать все результаты (>120) - acs366.phys.msu.su/ )

• Abstract (Invited)

... Small-Sowing Farms: Low-Powered or Nonoptimal? Structural analysis of social and economic processes of the Ukrainian rural area in the beginning of the New Economic Policy) . ... Ezhegodnik (Economic Hystory. ... The comparison of two types of farms discovers that even in South Ukraine where there was the greatest number of victims of the 1922 famine, small sown areas weren't caused by the low-powered economic position of farm. ...

Еще в разделе: (Показать все результаты (>75) - hist.msu.ru/ )

... Becoming Your Own Boss Many people start a small business in order to enjoy the perceived rewards of freedom and independence. This is understandable because owning your own business can offer you the opportunity to experience freedom: . ... the freedom to earn as much as you want. ... It is fine for you to dream about becoming your own boss some day, however, before you put too much work into your business, make sure that the area you choose is the right one for you. ...

Еще в разделе: (Показать все результаты (>33) - innovation.msu.ru/ )

• http://www.innovation.msu.ru/english/methodsforfinancingfourcompany.doc