... В начале предложений после этих наречий может ставиться запятая, но может и не ставиться (в зависимости от того, предусматривается ли в этом месте короткая пауза или нет; см. п. 7.1 см. п. 7.1 ). ... Заметим, что соединительное наречие может ставиться не только в начале предложения, но и в каком-либо уместном месте внутри него: . ... Напомним еще раз: если however стоит в начале предложения и после него нет запятой, то тогда however не соединительное наречие, а просто наречие: . ...

Еще в разделе: (Показать все результаты (>296) - num-anal.srcc.msu.ru/ )

... Активные темы Список участников Поиск по форуму Помощь . ... Тема: Order Allegra Ordering Without Prescripti . ... http://oo.free-best-hosting.com/pictures.php http://oo.free-best-hosting.com/images/ order /pictures.php Best buy Allegra Affordable Purchase Allegra Allegra Order Cash On Delivery Purchase Allegra Order Allegra C.O.D. Buy Allegra Buying Allegra Order Cash On Delivery Buying Allegra No Prescription Free Shipping Delivery Order Allegra Buy Cheap ...

Еще в разделе: (Показать все результаты (>10853) - www.sevin.ru/ )

• Экологический Форум - Фундаментальная Экология: a roughly order the of
• Экологический Форум - Фундаментальная Экология: Order Revitalizinghairoil Free
• Экологический Форум - Фундаментальная Экология: Order Levitrasuperactive Free

Новости кафедры . ... Кафедра общей физики и . физики конденсированного состояния . Физический факультет . ... О кафедре . ... Общая информация . ... Естественные факультеты . История кафедры . Лекции по общей физике . Контактная информация . ... Практикум . ... Информация о практикуме . ... Компакт-Диск "Практикум" . ...

Еще в разделе: (Показать все результаты (>26) - ferro.phys.msu.ru/ )

• Department of General Physics and magneto-ordered matter. Physics Faculty of
• Department of General Physics and magneto-ordered matter. Physics Department of

Электронная библиотека Попечительского совета . ... Jameson G. - Ordered Linear Spaces . ... Название: Ordered Linear Spaces . Автор: Jameson G. Язык: . ... Barrelled space xi 103-105 . ... Bornological space xi . ... Closed ordering 85 . ... Half-space 23 . ... k-space 61 . L-space 167 . ... Lexicographic ordering 6 . ... M-space 159 . ... Ordered direct sum 16 43 59 62 . ... Regular order-convex sub-space 37 . ... Электронная библиотека попечительского совета мехмата МГУ , 2004-2016 . ...

Еще в разделе: (Показать все результаты (>9737) - lib.mexmat.ru/ )

• Husain T., Khaleelulla S.M. - Barrelledness in Topological and Ordered Vector
• Поиск книг, содержащих Linearly ordered set :: Электронная библиотека
• Поиск книг, содержащих Partially ordered vector space :: Электронная библиотека

... Content Model: Optional list header (LH), followed by one or more list items (LI) . An unordered list typically is a bulleted list of items. ... Note: Some legacy documents may include headers or plain text before the first LI element. ... DIR lists are used to present lists of items containing up to 20 characters each. ... CLASS . ... The WRAP attribute is used for multicolumn lists. Use wrap=vert if you want to arrange the list items down the page before wrapping to the next column. ...

Еще в разделе: (Показать все результаты (>99) - comet.sai.msu.ru/ )

• Ordered Lists
• Examples of changing the sort order
• Options that can be used to change the sort order

... Semantics of Nonblocking Communications . ... The semantics of nonblocking communication is defined by suitably extending the definitions in Section Semantics of point-to-point communication . Order Nonblocking communication operations are ordered according to the execution order of the calls that initiate the communication. The non-overtaking requirement of Section Semantics of point-to-point communication is extended to nonblocking communication, with this definition of order being used. ...

Еще в разделе: (Показать все результаты (>348) - www.parallel.ru/ )

• Subarray Datatype Constructor | PARALLEL.RU - Информационно-аналитический центр
• Definitions | PARALLEL.RU - Информационно-аналитический центр по параллельным
• Distributed Array Datatype Constructor | PARALLEL.RU -

... 2016-Apr-03 18:14:59 . ... application/octet-stream . ... text/xml . ... 0.9K . text/plain . ...

Еще в разделе: (Показать все результаты (>16390) - mirror.msu.net/ )

• Index of /pub/gentoo-portage/dev-ruby/thread_order/

... Order on Establishing ERC . ... To consolidate efforts of MSU units aimed at research and development and education in nanotechnology and nanosystems . ... To establish MSU Nanotechnology Education and Research Center (ERC). In order to devise the development strategy and address the most important ERC matters to establish ERC Council consisting of: . ... Kirpichnikov Mikhail, Dean, Faculty of Biology, MSU . ... To approve the Statutes of the MSU Nanotechnology Education and Research Center . ...

Еще в разделе: (Показать все результаты (>24) - nano.msu.ru/ )

• Statute on the Methodical Commissions of the MSU Nanotechnology Education and

... Next: Window scrolling Up: Dealing with Windows Previous: Dealing with Windows Contents Index . Ordering Windows can be done by two Commands Cascade and Tile from the Menu Window. The Command Cascade will put the Windows one after another in diagonal direction starting from the upper left corner of the Window. The Command Tile put the Windows without intersection one by one from left to right and from up to down. ...

Еще в разделе: (Показать все результаты (>59) - www.spm.genebee.msu.ru/ )

How to order pictures . The works of our photographers are available for purchase in Books, Posters, Calendars, and as a digital pictures on CD. Click on any of the following sections and choose from a variety of high quality EcoPhoto products. Books . Fine Prints/Posters . Calendars . ... Placing an order is easy. Orders can be made via e-mail, or post. Acceptable forms of payment are cash, money order, and personal check. ... Moscow State University Science Park, . ...

Еще в разделе: (Показать все результаты (>588) - www.fadr.msu.ru/ )

• "EcoPhoto" - Order images - Posters
• Фотоархив "EcoPhoto" - Order images - Posters
• "EcoPhoto" - Order photo - CD

... О UNИX . ... HelpOnCreoleSyntax . Неизменяемая страница . ... Table of Contents . Headings . ... Contents** (up to the 2nd level) <<TableOfContents(2)>> . ... Parsers <<TableOfContents()>> = heading 1st level = == heading 2nd level == === heading 3rd level === ==== heading 4th level ==== ===== heading 5th level ===== . ... TIME@ inserts date and time of modification {{{ def hello(): print "Hello World!" }}} def hello(): print "Hello World!" {{{ #!python def hello(): print "Hello World!" }}} . ...

Еще в разделе: (Показать все результаты (>284) - uneex.mithril.cs.msu.su/ )

• HelpOnMoinWikiSyntax - UNИX

... О UNИX . ... HelpOnCreoleSyntax . Неизменяемая страница . ... Table of Contents . Headings . ... Contents** (up to the 2nd level) <<TableOfContents(2)>> . ... Parsers <<TableOfContents()>> = heading 1st level = == heading 2nd level == === heading 3rd level === ==== heading 4th level ==== ===== heading 5th level ===== . ... TIME@ inserts date and time of modification {{{ def hello(): print "Hello World!" }}} def hello(): print "Hello World!" {{{ #!python def hello(): print "Hello World!" }}} . ...

Еще в разделе: (Показать все результаты (>700) - uneex.lorien.cs.msu.su/ )

• Apache 2.0 Hook Functions - Apache HTTP Server
• HelpOnMoinWikiSyntax - UNИX
• Preface

... PHP 4 >= 4.0.6) mb_detect_order -- Set/Get character encoding detection order . array mb_detect_order ( [mixed encoding-list]) . mb_detect_order() sets automatic character encoding detection order to encoding-list . ... Set detection order by enumerated list */ mb_detect_order("eucjp-win,sjis-win,UTF-8"); /* Set detection order by array */ $ary[] = "ASCII"; $ary[] = "JIS"; $ary[] = "EUC-JP"; mb_detect_order($ary); /* Display current detection order */ echo implode(", ", mb_detect_order()); . ...

Еще в разделе: (Показать все результаты (>349) - oit.cmc.msu.ru/ )

• yp_order
• array_multisort
• preg_match_all

... Previous message: [Comphep-common] about batch calculation (fwd) . Next message: [Comphep-common] Re: Land a job real quick-order a diploma! q0w . Messages sorted by: [ date ] [ thread ] [ subject ] [ author ] . ...

Еще в разделе: (Показать все результаты (>11337) - theory.sinp.msu.ru/ )

• [Comphep-common] Re: Land a job real quick-order a diploma! q0w
• QCD scale
• Polar vectors

... Главная -> Фильмы -> The Order . ... Тайна "ордена" . ... В Иерусалиме заљавантюристом сољскандальной репутацией сразу начинают охотиться наемные убийцы иљполиция вољглаве сљотважной Далией Барр, которая нељраз спасет Руди жизнь вољвремя головокружительных погонь иљбешеных перестрелок наљузких улочках древнего города, прежде чемљему удастся разоблачить глобальный заговор безумного главаря ?Ордена? стремящегося начать новую Священную войну иљустановить наљЗемле власть крови иљтеррора. [ klepa ] . ...

Еще в разделе: (Показать все результаты (>601) - kinfo.ru/ )

• The Sin Eater (the Order) - Фильмы - Kinfo.ru
• Law & Order: Trial by Jury - Фильмы - Kinfo.ru
• Out of Order - Фильмы - Kinfo.ru

... The results of recent developments on modelling of supramolecular ordering and macroscopic properties of molecular liquids and mixtures are reviewed. ... The hierarchy of theoretical models of molecular aggregates is considered. The nonideal mixture of molecular aggregates, polyvariant as regards structure and composition, is discussed. ... Macroscopic manifestations of supramolecular ordering in a set of the physicochemical properties of molecular liquids and mixtures are discussed. ...

Еще в разделе: (Показать все результаты (>1082) - chem.msu.ru/ )

• Moscow University Chemistry Bulletin Vol. 51, No. 4, P. 274 (2010)
• Moscow University Chemistry Bulletin Vol. 45, No. 4, P. 231 (2004)
• Moscow University Chemistry Bulletin Vol. 45, No. 1, P. 19 (2004)

... Пользователи -General- Common Current University Society Study Diaspora FAQ Real Estate -Technical- Development Hard&Soft Network Mobile -Market- Market Services Job -Hobby- Behemoth Health Love&Sex Еда Media Games Auto&Moto Sport Hobby Flood Zone -Servant- Alternative Forums Forum -Garbage- Revolution Garbage Private . ... ищу Spellforce: Order of Dawn . ... Re: ищу Spellforce: Order of Dawn [ re: KAYZER ] . ... Есть Spellforce: Gold Edition. ... Re: ищу Spellforce: Order of Dawn [ re: Uncorn ] . ...

Еще в разделе: (Показать все результаты (>36766) - www.fds-net.ru/ )

• Money Order в Москве - Public forum of MSU united student networks
• International money order - Public forum of MSU united student networks
• Anarchy results in order - Public forum of MSU united student networks

... Пользователи -General- Common Current University Society Study Diaspora FAQ Real Estate -Technical- Development Hard&Soft Network Mobile -Market- Market Services Job -Hobby- Behemoth Health Love&Sex Еда Media Games Auto&Moto Sport Hobby Flood Zone -Servant- Alternative Forums Forum -Garbage- Revolution Garbage Private . ... Payment method : Mail Order/Fax Order . ... Re: Payment method : Mail Order/Fax Order [ re: PropellerMan ] . ... Re: Payment method : Mail Order/Fax Order [ re: freeze ] . ...

Еще в разделе: (Показать все результаты (>21332) - www.snto-msu.net/ )

• Money Order в Москве - Public forum of MSU united student networks
• Anarchy results in order - Public forum of MSU united student networks
• [T-SQL] Как правильно JOIN'нить таблицу с самой собой? - Public forum of MSU

AC201621_1 [925 - 1275] Candidatus Regiella insecticola clone CUGI_APP_BA-012A24, WORKING DRAFT SEQUENCE, 2 ordered pieces. MLSSITTRKKPQSIANQSRCSWVTNPANCPHSQAASIHTTKVITAKTIGGSKNNAHITIG IKIKAVIKRYFSKRVSPKMLLHRYRQVRVPQNDAHVGQTLPMPFQKQVHQNQARVYL >AC201621_2 [3300 - 3587] Candidatus Regiella insecticola clone CUGI_APP_BA-012A24, WORKING DRAFT SEQUENCE, 2 ordered pieces. ...

Еще в разделе: (Показать все результаты (>1604) - kodomo.cmm.msu.ru/ )

• http://kodomo.cmm.msu.ru/~tregubova/projects/Term_3/ac201621.orf
• http://kodomo.cmm.msu.ru/~ksenechka91/names.txt
• Cyclic cellular automata

... The role of electrostatic interactions on liquid crystalline ordering of polymers has been discussed since famous papers by Onsager. ... As a result, we have predicted orienting action of the electrostatic forces and possibility of weak nematic ordering even in dilute solutions [2]. ... 2] I.I. Potemkin and A.R. Khokhlov, " Nematic Ordering in Dilute Solutions of Rodlike Polyelectrolytes ", J. Chem. ... PSMTLab . ... Chair of Polymer and Crystal Physics; . ...

Еще в разделе: (Показать все результаты (>157) - polly.phys.msu.ru/ )

• Publications of J.A. Martemyanova