... add secondary structure markup for sequence name of markup: SequenceSecondaryStructureMarkup short name of markup: ss Note that DSSP cannot handle mutiple models! ... 9 """A dictionary of default markup name -> markup class.""" . ... 11 def update ( * args ): . ... 18 class_name = markup_class . ... values (): . ... Markup ): . ... 62 def to_record ( self ): . ... 91 for number , monomer in enumerate ( self . ... 131 def parse_value ( monomer , value ): . ... 139 def repr_value ( monomer , value ): ...

Еще в разделе: (Показать все результаты (>72804) - kodomo.fbb.msu.ru/ )

• allpy: b520e79fd1f4 allpy/markups.py
• allpy: b412a580e998 allpy/sequence.py
• allpy: b520e79fd1f4 allpy/markup.py

... TWikiMetaData . ... Meta Data Syntax . ... META:FORM . ... Additional topic data, program-generated or from TWikiForms , is stored in META variable name/value pairs . TWikiMetaData uses META variables to store topic data that's separate from the main free-form content. ... Use META variables to format and display Meta Data. Format is the same as in TWikiVariables , except all fields have a key. ... Note: Please contribute updates to this topic on TWiki.org at TWiki:TWiki.TWikiMetaData . ...

Еще в разделе: (Показать все результаты (>49592) - dualopt1.cmm.msu.ru/ )

• %TOPICTITLE% (2 vs. 3) - TWiki
• %TOPICTITLE% (7 vs. 8) - TWiki
• %TOPICTITLE% (4 vs. 5) - TWiki

Here is an example of an alignment for input for the program " Geometrical Core ". Note that the names of sequences should be of the form: . PDBcode_Chain[_Model] . 1ADR_A_2 LMGERIRARRKKLKIRQAALGKMVGVSNVAISQWERSETEPNGENLLALSKALQCS PDYLLKGD

Еще в разделе: (Показать все результаты (>7274) - mouse.belozersky.msu.ru/ )

• SVETKA, a program for multiple sequence alignments analysis

IEN 61 Section 2.5.6.1 Internet Name Server Jon Postel 27 October 1978 Information Sciences Institute University of Southern California 4676 Admiralty Way Marina del Rey, California 90291 (213) 822-1511 INTERNET NAME SERVER -------------------- NAME SYNTAX It is strongly recommended that the use of host names in programs be consistent for both input and output across all hosts. ... NAME SERVER To aid in the translation of names to internet addresses, several name server processes will be provided. ...

Еще в разделе: (Показать все результаты (>54975) - mirror.msu.net/ )

• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/pdfrfc/rfc606.txt.pdf
• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/rfc606.txt
• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/rfc5179.txt

... Note you are not allowed to nest FORM elements! ... Forms are created by placing input fields within paragraphs, preformatted text, lists and tables. ... Notice the use of the NAME attribute to name each field : TITLE Sample Questionaire /TITLE H1 Sample Questionaire /H1 P Please fill out this questionaire: FORM METHOD=post ACTION= http://www.hal.com/sample P Your name : input name = name size= 48 P input name = male type =radio Male P input ...

Еще в разделе: (Показать все результаты (>685) - comet.sai.msu.ru/ )

• Fill-Out Forms
• Examples of environment variable names
• Definition Lists

IMPALA: Integrating Matrix Profiles And Local Alignments 1. ... Primary preprocessing Prepare the following files : i. a collection of PSI-BLAST-generated profiles with arbitrary names and suffix .chk; ii. a collection of profile master sequences , associated with the profiles , each in a separate file with arbitrary name and a 3 character suffix starting with c; the sequences can have deflines; they need not be sequences in nr or in any other sequence ...

Еще в разделе: (Показать все результаты (>9604) - kodomo.cmm.msu.ru/ )

• http://kodomo.cmm.msu.su/trac/tanchiki/wiki/WikiProcessors?format=txt
• WikiProcessors тАУ Tanchiki
• Help: patterns

Next: Name Lookups with DNS Up: The Domain Name System Previous: Hostname Resolution . DNS organizes host names in a hierarchy of domains. ... Below this top-level domain, each country's NIC is free to organize host names in whatever way they want. ... Now, organizing the name space in a hierarchy of domain names nicely solves the problem of name uniqueness; with DNS, a host name has to be unique only within its domain to give it a name different from all other hosts world-wide. ...

Еще в разделе: (Показать все результаты (>684) - itpm.msu.su/ )

• mod_vhost_alias - Apache HTTP Server
• Creating a user
• Definitions and Conventions

As it was already mentioned, the idea behind File Juggler is rather simple: using CGI scripts as processing tools and WWW browser as user interface, display the structure and content of typical anonymous FTP server in a convenient, easily navigated form. ... My P5-133 spends about 0.025 ms on one file when doing linear search with simple criterion (690 ms for 27,000 files, search for substring among file names/descriptions with 70 hits). ... Let's now look whether we can handle 1,000,000 files. ...

Еще в разделе: (Показать все результаты (>7648) - crydee.sai.msu.ru/ )

• Dynamic HTML in Communicator
• Recursion
• Tutorial on Fortran 90, Digital UNIX

SDPpred: a tool for prediction of amino acid residues that determine differences in functional specificity of homologous proteins . The GDE alignment format is one of the standard alignment formats. Popular programs for sequence alignment, e.g. ClustalW, can save alignment in this format. ... Sequences are placed one after another, the name of each sequence is placed onto a separate line and begins with ‘%’. ... Thus the alignment looks like this: . ... back to input format rules . ...

Еще в разделе: (Показать все результаты (>1554) - monkey.belozersky.msu.ru/ )

• Inquiry information || Distances
• SVETKA, a program for multiple sequence alignments analysus
• SVETKA, a program for multiple sequence alignments analysis

. Developed by ValVe . Uses gnuplot v4

Еще в разделе: (Показать все результаты (>2) - depni.sinp.msu.ru/ )

... To reserve a room in the MSU Dormitory/Hotel and other hotels, please fill out and submit the form below before May 10, 2002 . ... A single room costs approximately 5 USD per night. ... If you have another ISNA participant who would like to share the appartment with you, please fill the boxes below and ask him/her to do the same in his/her Hotel Room Reservation Form. ... A single room costs 30 - 40 USD, a double room costs 60 USD, a single room in 2-room appartment costs 18 USD/night). ...

Еще в разделе: (Показать все результаты (>170) - acs366.phys.msu.su/ )

... Package . Class . ... FRAMES NO FRAMES . ... Class ucar.multiarray.MultiArrayImpl implements Serializable . Serialized Fields java.lang.Object storage . ... Class ucar.netcdf.Attribute implements Serializable . Serialized Fields java.lang.String name . ... Class ucar.netcdf.Dimension implements Serializable . Serialized Fields int length . ... Class ucar.netcdf.NetcdfRemoteProxyImpl implements Serializable . ... Class ucar.netcdf.NetcdfRemoteProxyImpl_Stub implements Serializable . ...

Еще в разделе: (Показать все результаты (>152) - angel.cs.msu.su/ )

• Appendix A Units
• : Class Attribute
• : Class Dimension

... All circuit parameters have been presented in a symbolic form. ... To use the program you will need a CIR file (PSpise, DesignLab file) of your circuit. CIR file examples have been enclosured: bpasside.cir, test1.cir, test2.cir, test3.cir, test4.cir, laksamp.cir, bridge.cir, uA741acf.cir, quartz.cir. ... Ideal operational amplifier (nullor) * Nname n1 n2 n3 n4 * * In the ideal op amp data, (n1,n2) represent output nodes, * (n3,n4) represent input nodes (noninverting, inverting). ...

Еще в разделе: (Показать все результаты (>22) - astrometric.sai.msu.ru/ )

• Symbolic matrix processor
• Complex evaluator

fitshdr_edit - FITS-file headers interactive editor fitshdr_edit [options] FITSfile_name . fitshdr_edit utility allows to modify FITS headers' lines interactively (FITS MultiExtentionsFiles included). fitshdr_edit is just simple shell script around fitshdr utility. ... It means, that You can't remove line from header! ... 560:CRDELT2 = 21.0 / this is example 640: 720:HISTORY header No.0: 1st history line 123456789012345678901234567 880:COMMENT Sat Sep 25 21:17:34 CEST 2004 / by fitshdr_edit . ...

Еще в разделе: (Показать все результаты (>299) - lnfm1.sai.msu.ru/ )

• Manpage of FITSHDR
• IDL programs

... Hassner A., Stumer C. - Organic Syntheses Based on Name Reactions and Unnamed reactions . ... Название: Organic Syntheses Based on Name Reactions and Unnamed reactions . ... Synthetically useful organic reactions or reagents are often referred to by the name of the discoverer(s) or developer(s). Older name reactions are described in text books, but more recently developed synthetically useful reactions that may have been associated occasionally with a name are not always well known. ...

Еще в разделе: (Показать все результаты (>17761) - lib.mexmat.ru/ )

• Elliott M. - Lotus Notes Developer's Toolbox: Tips for Rapid and Successful
• Gooden P. - Name Dropping: A No-nonsense Guide to the Use of Names in Everyday
• Elias S., Gima P. - Domain Names: How to Choose and Protect a Great Name for

... Run program . User's guide . Launching program . Input data format . ... Selecting the number of correlated pairs . ... In order to run thr program one needs Java 5.0 environment. ... At the end of computations one will be asked to review the selected number of correlated pairs. ... Note: One may redefine the number of correlated pairs by selecting the 'Edit' -> 'redefine correlated pairs number' menu item. Correlated pairs of positions are presented as a colored matrix, the heatmap. ...

Еще в разделе: (Показать все результаты (>145) - bioinf.fbb.msu.ru/ )

• SDPpred
• Input Formats
• SDPlight

All Firefly versions can take optional command line arguments. ... firefly [optional command line options in any order] [optional list of working directories] . ... The list of most widely used command line options is given below: . ... Disables validity check of the command line arguments (e.g., check for valid names of files and directories, etc...) passed to Firefly. ... However, if this option is not given, one must provide the list of working directories when running Firefly in parallel mode. ...

Еще в разделе: (Показать все результаты (>138) - classic.chem.msu.su/ )

• Firefly Documentation
• PC GAMESS/Firefly DOCUMENTATION - list of supported Linux MPI implementations
• Lesson 3: two methods for preparing Firefly' input files with basis sets and

... Conference Schedule . ... Visa Support NEW! ... Registration . For registration at the 14th International Meeting of the International Humic Substances Society (IHSS) please download the Registration Form , fill it in, and send to the Conference Secretariat by e-mail ihss@org.chem.msu.ru . ... Registration Fee and/or Accommodation and/or Social Fee for Participation at the IHSS-14 Conference from " Full NAME of Participant(s) " . ... September 13, 2008, 9 a.m. - 9 p.m. - Arrival Day . ...

Еще в разделе: (Показать все результаты (>159) - mgumus.chem.msu.ru/ )

... Guidelines for Paper Submission . ... The program committee will schedule both oral and poster sessions. The abstract and summary of both oral and poster papers are published in the same manner in the Conference Program and the Technical Digest on CD-ROM. ... Oral Sessions . ... Poster Sessions . ... For poster sessions, authors are provided with bulletin boards on which to display their papers, along with a sign indicating their paper numbers, and pushтАУpins or adhesive tape. ... Program . ...

Еще в разделе: (Показать все результаты (>22) - iconolat13.phys.msu.ru/ )

О лаборатории . ... Лаборатория теоретической биофизики . ... continue reading..... ab initio basis sets cp2k education Firefly FRAP GAMESS gromacs MDAnalysis membrane mmb nano OPLS pymol python scipy sparse matrix toolset topology познавательно учебные материалы . ... All-atom automatic OPLS-AA topology generator . ... comcon1 in All-atom automatic OPLS-AA topology? . ... OPLS-AA? in All-atom automatic OPLS-AA topology? ... 2011 ERG Research Group . ...

Еще в разделе: (Показать все результаты (>42) - erg.biophys.msu.ru/ )

• Visual approach to construction of &QMMM section of CP2K input file ERG
• Peter Mamonov ERG Research Group: Лаборатория теоретической биофизики
• toolset ERG Research Group: Лаборатория теоретической биофизики