Some additional inquiry information . ... WPGMA . As any cluster method , UPGMA (unweighted pair-group method of analysis) performs the structure of a set of some homogeneous elements ( in our case alignment is a set of amino acid sequences ). ... Firstly, when we calculate correlations between distance matrices on the whole alignment and on separate position (for selecting "diagnostic" positions) - we should be sure that these data are not distorted by multiple repeating of one sequence. ...

Еще в разделе: (Показать все результаты (>6583) - monkey.belozersky.msu.ru/ )

• About authors ot this complex

... Minimal size of Clud clusters (residues) . ... An alignment of a set of structures is a set of positions , to each position some atoms from different structures correspond. ... Hydrophobic cluster of a single protein structure is a separated pool of nonpolar atoms. Usually there is the biggest cluster in the protein called hydrophobic core. ... ConClus program is able to detect of conservative hydrophobic clusters for a family of related protein domains or just for a set of aligned proteins. ...

Еще в разделе: (Показать все результаты (>32) - mouse.genebee.msu.ru/ )

Organization and evolution of piRNA clusters in mosquitoes Phillip George, Chantal Vaury, Silke Jensen, Igor V. Sharakhov Entomology Department, Virginia Polytechnic Institute ... Development (GReD), University of Clermont-Ferrand, ClermontFerrand, France, chantal.vaury@udamail.fr The Piwi-interacting RNA ( piRNA ) pathway is an important mechanism in the defense against transposable element (TE) mobilization in many species including ...

Еще в разделе: (Показать все результаты (>326) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/129.pdf
• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/101.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/149.pdf

... Algorithm & . Format requirements . ... SDPsite is a tool for identification of protein active and other functional sites, based on spatial clustering of SDPs (specificity-determining positions, described here ) with CPs (conserved positions). ... Mapping predictied positions onto structure and construction of the best cluster . ... The input data of the algorithm are a multiple protein alignment divided into specificity groups . ... is called statistical significance of the set of k* positions . ...

Еще в разделе: (Показать все результаты (>148) - bioinf.fbb.msu.ru/ )

• SDPlight

Электронная библиотека Попечительского совета . ... Driess M., N?th H. - Molecular Clusters of the Main Group Elements . ... Название: Molecular Clusters of the Main Group Elements . Авторы: Driess M., N?th H. Аннотация: . To summarize, Molecular Clusters of the Main Group Elements is certainly not a popular science book, nor is it a textbook; it is a very good, up-to-date collection of articles for the specialist. ... Электронная библиотека попечительского совета мехмата МГУ , 2004-2016 . ...

Еще в разделе: (Показать все результаты (>19967) - lib.mexmat.ru/ )

• Bohm-Vitense E. - Introduction to Stellar Astrophysics: Volume 3 :: Электронная
• Shapley H. - Studies of Magnitudes in Star Clusters II. On the Sequence of
• Dubinko M. - XForms Essentials :: Электронная библиотека попечительского совета

... Nanochemistry, 2nd Edition, reviews the synthesis, characterization, properties and applications of nanoparticles and clusters. ... Nanochemistry is an important branch of the actively developing interdisciplinary field of nanoscience, which studies the background, production processes and reactions of nanoparticles. ... Professor Gleb B. Sergeev has headed up a laboratory of low temperature Chemistry at the Chemistry Department of Moscow State University, has 380 publications and 3 monographs. ...

Еще в разделе: (Показать все результаты (>879) - chem.msu.ru/ )

... 10 import sequence . ... 12 import allpy_data . ... 33 Project(sequences, alignment) -> new Project with sequences and . ... 35 Project(fasta_file) -> new Project, read alignment and sequences . ... 40 self . ... 99 >>> sequences,alignment=project.Project.from_fasta(open("test.fasta")) . ... 135 alignment [ sequences [ - 1 ]] = alignment_list . ... 147 max_length = max ( len ( sequence ) for sequence in sequences ) . ... alignment [ sequence ] = sequence . ... 179 sequences , alignment = Project . ...

Еще в разделе: (Показать все результаты (>43524) - kodomo.fbb.msu.ru/ )

• allpy: ee2c10aa74b8 test/usecase2.py
• allpy: 56bea23d3c73 lib/block.py
• allpy: 1048b7a728e7 allpy/block.py

ABSOLUTE PROPER MOTIONS OF 331 OPEN CLUSTERS . ... The proper motions of stars in the fields of 331 open clusters were taken from Four-Million Star Catalog (4M-catalog) of positions and proper motions (Volchkov et al. ... The absolute proper motions for 21 young open clusters have been derived by comparison of precise relative proper motions of individual stars and their corresponding absolute proper motions. ... Sign of proper motions in RA . ... 0.0001 arcsec/yr . ... rms error in RA proper motion . ...

Еще в разделе: (Показать все результаты (>39) - www.sai.msu.ru/ )

CViz . CViz is a visualization tool designed for analyzing high-dimensional data (data with many elements) in large, complex data sets. CViz easily loads the data sets, displays the most important factors relating clusters of records, and provides full-motion visualization of the inherent data clusters. This tool is very useful for analysts who often use statistical methods. ... Available Binary Packages: . ... None . ... SAL Home | Scientific Data Processing Visualization | ...

Еще в разделе: (Показать все результаты (>6368) - www.sai.msu.su/ )

• Отдел Изучения Галактики и переменных звезд
• APOD Index - Stars: Globular Clusters
• APOD: 2012 April 3 - M46 and M47: Star Clusters Young and Old

... Description . Catalog . ... In the Catalog, we publish equatorial (ЮБ 2000 , ЮД 2000 ) and galactic (l,b) coordinates of cluster centers derived as the position of overdensity in 2MASS catalog (Koposov et al. ... Distances, color-excesses and ages are the mean-square values calculated using all available evaluations from different color-magnitude diagrams. ... There are individual pages for every cluster where all available plots and parameters are published. ... 2002). ...

Еще в разделе: (Показать все результаты (>222) - ocl.sai.msu.ru/ )

• SAI Open Star Clusters (SAI OCL) Catalog

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>223) - www.genebee.msu.ru/ )

• AliGraf - GeneBee Graphical Alignment Help
• RNA secondary structure prediction
• OUTPUT

M55 Color Magnitude Diagram . ... B.J. Mochejska , J. Kaluzny ( CAMK ), 1m Swope Telescope Explanation: This color "picture" of globular star cluster M55 may not look like any star cluster you've ever seen. ... In the picture, a Color Magnitude Diagram (CMD), M55's individual stars are represented as dots whose color indicates relative temperature, red (cool) to blue (hot). ... The broad swath extending diagonally from the lower right is the cluster's main sequence . ... Specific rights apply . ...

Еще в разделе: (Показать все результаты (>16569) - www.astronet.ru/ )

• The Dawn of the Clusters
• Астронет > The Dawn of the Clusters
• XWare > APOD

PETROTYP has been designed for clustering igneous rock compositions given as concentrations of major element oxides. This program is based on principles of hierarchical grouping of objects that are characterized by an array of parameters described as an objective function (Ward, 1963). The major principle involves a subsequent combining of samples having the minimum geochemical distance (GD) with respect to other rocks or average cluster compositions formed at a previous stage. ...

Еще в разделе: (Показать все результаты (>622) - geo.web.ru/ )

... Alternative core new atoms (%) . ... An alignment of a set of structures is a set of positions , to each position some atoms from different structures correspond. ... Geometrical core of a set of structures is a subset of alignment positions those atoms are disposed similarly in all structures. ... For any two positions included into geometrical core, the distances between CA atoms of those positions in all structures may differ not more than the value of the parameter "Distance spreading". ...

Еще в разделе: (Показать все результаты (>7048) - mouse.belozersky.msu.ru/ )

• PLANdbAffy: probe-level annotation database for Affymetrix expression
• wLake program homepage

Permitted Context: %math . ... This is represented in HTML math by: <array> <row><item>a_11_<item>a_12_<item> <item>a_1n_ <row><item> <item> <item> <item> <row><item>a_n1_<item>a_n2_<item> <item>a_nn_ </array> . ... This is represented by: <array coldef="C+C+C+C=C"> <row><item>a_11_x_1_<item>a_12_x_2_<item> <item>a_1n_x_n_<item>b_1_ <row><item>a_21_x_1_<item>a_22_x_2_<item> <item>a_2n_x_n_<item>b_2_ <row><item colspan=5> <row><item>a_n1_x_1_<item>a_n2_x_2_<item> <item>a_nn_x_n_<item>b_n_ </array> . ...

Еще в разделе: (Показать все результаты (>185) - comet.sai.msu.ru/ )

• Headings
• Horizontal Tabs
• Understanding HTML and SGML

Finding a collision for the 75-round SHA-1 hash function using clusters of GPUs" . ... With the aid of our application running on a 512-GPU cluster, we were able to find a collision for a version of SHA-1 reduced to 75 rounds, which is currently (February 2012) the world's best result in terms of number of rounds for SHA-1. Keywords: cryptoanalysis, cryptographic hash functions, building collisions, SHA-1, GPU, clusters, high-performance computing . PostScript (in Russian) (832KB) . ...

Еще в разделе: (Показать все результаты (>352) - num-meth.srcc.msu.ru/ )

• "A problem of synthesis of nano-optical elements for the formation of dynamic
• "Evaluation of clusters with AMD Barcelona and Shanghai CPUs and Infiniband DDR
• "Optimization algorithms for DSMC computations on parallel clusters"

... Chemistry of Coordination Compounds . ... Inorganic Synthesis . ... CLUSTERS AND EXTENDED METAL-METAL BOND SYSTEMS IN INORGANIC COMPOUNDS . ... Cluster compounds, structure & bonding, quantum chemistry . ... Inorganic synthesis, bismuth clusters, metal subhalides . ... inorganic synthesis, clusters, mixed chalcogenides . ... Design, synthesis and investigations of inorganic compounds featuring extended systems of homo- and heterometallic bonds of varying (1D, 2D) dimensionality. ... Kuznetsov . ...

Еще в разделе: (Показать все результаты (>119) - www.inorg.chem.msu.ru/ )

• Inorganic Synthesis Laboratory - Supramolecular and Cluster Compounds

Projects . ... Modeling the tmRNA structure in the ribosome . For modeling of the tmRNA-2 structure in the ribosome we used the published ribosome X-ray structure with a defined mRNA path (Yusupova et al, 2006). ... Since the arch consisting of tmRNA pseudoknots and helices was observed by cryo-EM in the pre-initiation complex (Valle et al, 2003) as well as in the tmRNA-4 complex described here, we suggest that such a structure should be present at all steps of the tmRNA path through the ribosome. ...

Еще в разделе: (Показать все результаты (>38098) - dualopt1.cmm.msu.ru/ )

• PatternSkinCss - TWiki - TWiki

... MATHEMATICAL AND SYSTEM BIOLOGY UDC 577.1 Membrane Profile-Based Probabilistic Method for Predicting Transmembrane Segments via Multiple Protein Sequence Alignment R. A. Sutormina and A. A. Mironova a b , b, c State Research Center GosNIIgenetika, Moscow, 117545 Russia; e-mail: sutor_ra@mail ... Bioinformatics, Moscow State University, Moscow, 119992 Russia Received January 25, 2006 Abstract--Prediction of transmembrane (TM) segments of amino ... Protein Sci. ... Proteins. ...

Еще в разделе: (Показать все результаты (>13) - storage.bioinf.fbb.msu.ru/ )

• http://storage.bioinf.fbb.msu.ru/~roman/batmas30.pdf
• http://storage.bioinf.fbb.msu.ru/~roman/Sutormin_CV_aug2013.pdf
• http://storage.bioinf.fbb.msu.ru/~roman/Sutormin_CV_aug2014.pdf

The processes of electron-positron annihilation into photon pairs and of pair creation by photons are of interest both theoretically and experimentally. ... This should come as some surprise since you probably know that by crossing you should expect each of the two Compton diagrams to give rise to one Feynman diagram for the annihilation process (see, for instance, [ 2 ] Section 7.8, [ 1 ] Section 6.15). ... see section ) and hence get the following formula for the total cross section: . ...

Еще в разделе: (Показать все результаты (>3871) - theory.sinp.msu.ru/ )

• Polar vectors
• Elastic scattering of electrons and positrons.
• Parameterization via decay scheme