Электронная библиотека . ... Главная Ex Libris Книги Журналы Статьи Серии Каталог Wanted Загрузка ХудЛит Справка Поиск по индексам Поиск . ... Поиск по указателям . Результат поиска . Книга . Страницы для поиска . ... Электронная библиотека попечительского совета мехмата МГУ , 2004-2016 . ...

Еще в разделе: (Показать все результаты (>229) - lib.mexmat.ru/ )

• Benko C., McFarlan F.W. - Connecting the Dots: Aligning Projects with
• Поиск книг, содержащих align (окружение) :: Электронная библиотека

... PYRB_ECOLI 51 EASTRTRLSFETSMHRLGASVVGFSDSANTSLGKKGETLADTISVISTYV 100 PYRB_VIBCH 101 DAFVMRHPQEGAARLASEFSNGVPVINAGDGSNQHPSQTLLDLYSIFETQ 150 || PYRB_ECOLI 101 DAIVMRHPQEGAARLATEFSGNVPVLNAGDGSNQHPTQTLLDLFTIQETQ 150 PYRB_VIBCH 151 GRLDNLDVAFVGDLKYGRTVHSLAQALAKFDNNRFYFVAPEALAMPDYIC 200 || PYRB_ECOLI 151 GRLDNLHVAMVGDLKYGRTVHSLTQALAKFDGNRFYFIAPDALAMPQYIL 200 PYRB_VIBCH 201 EELDEAGVKYQVFSDMESVIPELDILYMTRVQKERFDESEYAHIKSAYIL 250 :.| ...

Еще в разделе: (Показать все результаты (>3134) - kodomo.fbb.msu.ru/ )

• Help to practice 11 (Structural alignment)
• allpy: 3d40d7b9a123 lib/align.py
• allpy: lib/align.py diff

... Muscle и GeneDoc . Программа muscle из набора последовательностей делает выравниваение. ... Большое количество консервативных участков, небольшое гэпов. ... Консервативные участки единичны (столбцы выравнивания/номера а.о. HEMH_BACSU: 14-15/9-10, 19/14, 21/16, 29/22, 32/25, 72/47, 83-85/54-56, 96/67, 130/100, 149/117, 178/144, 181/147, 213/179, 215/181, 217/183, 219-220/185-186, 254/196, 280/218, 282-284/220-222, 293-294/230-231, 296/233, 321/258, 327/264, 329/266, 364/300, 367/303). ...

Еще в разделе: (Показать все результаты (>1359) - kodomo.cmm.msu.ru/ )

• task 12
• Aligments
• align

Выберите категорию обращения: Общие вопросы Отчеты Рейтинги Диссертационные советы Конкурсы Ввод данных Структура организаций Пользователи Проблемы с регистрацией\входом в систему . ... Войти в систему . ... von dem Borne A. , Dohrmann T. , Verweyen A. , Sonntag B. , Godehusen K. , Zimmermann P. , Kabachnik N.M. в журнале Journal of Physics B: Atomic, Molecular and Optical Physics , издательство Institute of Physics Publishing (United Kingdom) , том 31, ? ...

Еще в разделе: (Показать все результаты (>57) - istina.msu.ru/ )

• Wedowski M. - сотрудник | ИСТИНА - Интеллектуальная Система Тематического
• Weisbarth F. - сотрудник | ИСТИНА - Интеллектуальная Система Тематического
• von dem Borne A. - сотрудник | ИСТИНА - Интеллектуальная Система Тематического

This diagram shows how the 'vertical-align' properties on cells combine to determine the height of the row containing the cells. The diagram also illustrates the meaning of some values of 'vertical-align' that apply to table cells: baseline, top, bottom, and middle. The diagram shows a row of five (labeled) table cells of varying heights and alignments. ... The first cell is aligned with the row baseline and extends to just below the row top. ...

Еще в разделе: (Показать все результаты (>232) - crydee.sai.msu.ru/ )

• Permanent Waves Lyrics
• Chronicles Lyrics
• Retrospective Lyrics

. Name . Last Modified . Size . Type . Parent Directory / . - . Directory . ChangeLog . 2016-Jan-25 18:21:21 . 2.4K . application/octet-stream . ChangeLog-2015 . 2015-Nov-09 07:11:44 . 7.2K . application/octet-stream . Manifest . 2016-Jan-25 18:21:21 . 1.8K . application/octet-stream . align-43.ebuild . 2015-Aug-09 03:38:18 . 0.3K . text/plain . metadata.xml . 2016-Jan-25 02:06:09 . 0.2K . text/xml . lighttpd/1.4.35

Еще в разделе: (Показать все результаты (>1635) - mirror.msu.net/ )

• Index of /pub/gentoo-portage/sci-chemistry/tm-align/
• Index of /pub/gentoo-portage/app-vim/easy-align/
• Index of /pub/gentoo-portage/sci-chemistry/mm-align/

... Sequence conservation . ... 7 PDB entries containing coordinates of HTH3 domains were used in this study. These entries represent 4 proteins from two bacteriphages: phage lambda and phage 434. ... Lambda C1 repressor . Bacteriophage lambda . ... 434 C1 repressor . ... Line Aligned shows whether the respective residues are aligned on structural alignment, A stands for aligned residues, L stands for second structure elements which are similarly arranged in space, but actually cannot be aligned. ...

Еще в разделе: (Показать все результаты (>9) - monkey.belozersky.msu.ru/ )

• ETS numeration assumed
• Homeodomain numeration assumed

Protein docking algorithm based on structural homology with protein-protein interfaces T. Kirys, A.V. Tuzikov United Institute of Informatics Problems, National Academy of Sciences of Belarus, Surganova, 6, Minsk, tuzikov@newman.bas-net.by An original protein docking algorithm based on structural similarity with experimentally determined protein-protein interfaces is proposed. ... The alignment is performed by dynamic programming on distance matrices of protein and interface. ...

Еще в разделе: (Показать все результаты (>33) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/104.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/76.pdf

... TWikiHistory 33 - 2001-04-05 - PeterThoeny . ... empty cells || ... AndreaSterbini , PeterThoeny - 28 Feb 2001: New Wiki rule for headings, i.e. ---++ My Title ; and new %TOC% variable to build a table of content from headings in a topic. ... PeterThoeny - 28 Feb 2001: New Wiki rule to specify arbitrary text for external links (i.e. [[http://TWki.org][TWiki]] ) and internal links (i.e [[WikiSyntax][syntax]] ). ... PeterThoeny - 28 Feb 2001: New Wiki rule for named anchors, e.g. links within a topic....

Еще в разделе: (Показать все результаты (>12289) - dualopt1.cmm.msu.ru/ )

• %TOPICTITLE% (31 vs. 35) - TWiki
• PatternSkinCssCookbookEditTableStyle - TWiki - TWiki - (printable)
• WysiwygPluginSettings - TWiki - TWiki

... A CD-ROM drive uses an optically read, plastic coated disk. ... CD-ROM drives are slow compared to hard disks. ... The slowness means that CD-ROM drives are not as pleasant to use instead of hard disks (some Linux distributions provide `live' filesystems on CD-ROM's, making it unnecessary to copy the files to the hard disk, making installation easier and saving a lot of hard disk space), although it is still possible. ... The most popular one is specified by the international standard ISO 9660. ...

Еще в разделе: (Показать все результаты (>22) - itpm.msu.su/ )

... Content Model: Table Cells (TH or TD) . The TR element acts as a container for a row of table cells defined with the TH or TD elements. ... You also have the ability to disable word wrap for the row, and thereafter use the <BR> element to determine line breaks and hence cell widths. ... The recommended approach is to subclass rows using the CLASS attribute For example: <TABLE BORDER COLSPEC= .. ... ALIGN . ... This is used when you want to ensure that all cells in the row share the same baseline. ...

Еще в разделе: (Показать все результаты (>20) - comet.sai.msu.ru/ )

• HTML Math
• Horizontal Tabs
• Definition Lists

. The algorithm builds multiple alignment of conservative blocks and find consistent sets of helices. The input data may contain junk sequences. Department of Department of Bioengineering and Bioinformatics, MSU, Moscow, Russia . Mail to Andrey Mironov .

Еще в разделе: (Показать все результаты (>3) - bioinf.fbb.msu.ru/ )

• User's guide

tfoot> <tr><th align="left">Область</th> <th align="left">Тип книги</th> <th>Год</th> <th>Название, формат и ссылка</th> <th></th> <th>Размер, Mb</th> <th>Добавлено</th> <th>Комментарий</th> </tfoot> </table> <br> <p>Чтобы <strong>найти книгу</strong>, нужно напечатать любую часть ее названия в поле поиска. ... В любом случае пособия разрешается использовать исключительно в образовательных и научных целях. <p>Многие книги выложены в формате <strong>DjVu</strong>. ...

Еще в разделе: (Показать все результаты (>7) - herba.msu.ru/ )

• http://herba.msu.ru/shipunov/school/src/sch-ru.head

... cheap longchamp . cheap the north face . ... cheap moncler . ... 2016 С Днем Победы! ... win 7 ultimate product key Windows 8 key windows 7 key win 7 key windows 7 pro product key win 7 pro product key windows 7 activation key windows 7 ultimate product key windows 7 ultimate serial key windows 7 key online win 7 ultimate key win 7 serial keys Win 7 ultimate key Win 7 ultimate product ...

Еще в разделе: (Показать все результаты (>4) - elana.sinp.msu.ru/ )

GMATCH . That projects is aimed for the solution of the well known problem of all observational astronomers -- the WCS alignement of the images. It is always great to have the possibility to determine the exact J2000 coordinates of each point of the frame. It is always great to not manually align the images before summing them. My program is aimed to solve all those problems. ... Download . ... WCSLIB library (by M. Calabretta)(download from here ) . ...

Еще в разделе: (Показать все результаты (>10) - lnfm1.sai.msu.ru/ )

... In 2007 T. Yankova graduated cum laude from Chemistry Department of Lomonosov Moscow State University and continued education as PhD student. ... Vorobiev). ... E-mail: ya.tatiana@gmail.com . Chumakova N.A., Yankova T.S., Vorobiev A. Kh., ... PDF . ... Vorobiev, T.S. Yankova, N. A. Chumakova, Orientation distribution function and order parameters of oriented spin probe as determined by EPR spectroscopy // Chemical Physics 409 (2012) 61-73. ... T.S. Yankova, N.A. Chumakova, D.A. Pomogailo, A.Kh. ...

Еще в разделе: (Показать все результаты (>26) - chem.msu.ru/ )

• Янкова Татьяна Сергеевна
• Daria A. Pomogailo
• Помогайло Дарья Анатольевна

... Gif/brick.gif p align= center applet code=map_view.class name =red width=250 height=250 archive=map_view.zip codebase= ../ mayscript param name =bgcolor value =#00DFDF param name =layers_all value = sq rect1 rect2 rect3 rect4 param name =layers_draw value = #sq #rect1 #rect3 #rect2 #rect4 param name =sq value = draw_layer= ...

Еще в разделе: (Показать все результаты (>10) - adept.srcc.msu.ru/ )

• http://adept.srcc.msu.ru/adept/java/applet_book/point/point1text1.htm
• http://adept.srcc.msu.ru/adept/java/applet_book/point/point2text1.htm
• http://adept.srcc.msu.ru/adept/java/applet_book/promt/promt1text1.htm

ARM . 12: · ARM 2 ARM Powered Products 3 ARM · 4 · ARM 32- . ARM : ­ Byte - 8 bits ­ Halfword - 16 bits ( ) ­ Word - 32 bits ( ) · ARM ­ 32-bit ARM Instruction Set ­ 16-bit Thumb Instruction Set 5 · ARM : ­ User : , ­ FIQ : , high priority (fast) ­ IRQ : , low priority (normal) ­ Supervisor : Software Interrupt instruction ­ Abort : ­ Undef : ­ System : , 6 User ARM Current Visible Registers Abo Und rtMod SVCMode IRQ ef Mode FIQ Mode e User ...

Еще в разделе: (Показать все результаты (>2) - lvk.cs.msu.su/ )

. "> . группа . " height="100" border="0" alt="Фото" align="absmiddle"> . "):""?> ".$row["firstname"]." . ":""?> .

20. http://imaging.cs.msu.ru/files/courses/ipintro2012/sample_code.m