... Algorithm & . Format requirements . ... SDPsite is a tool for identification of protein active and other functional sites, based on spatial clustering of SDPs (specificity-determining positions, described here ) with CPs (conserved positions). ... Mapping predictied positions onto structure and construction of the best cluster . ... The input data of the algorithm are a multiple protein alignment divided into specificity groups . ... is called statistical significance of the set of k* positions . ...

Еще в разделе: (Показать все результаты (>146) - bioinf.fbb.msu.ru/ )

• SDPlight
• SDPpred

. Next: Initial velocity Up: Space and velocity distributions Previous: Space and velocity distributions . Following Paczynsky (1990), we assume initial space distribution of young neutron stars to be varying exponentially with distance from the Galactic center and from the Galactic plane, that is probability distribution for young neutron star positions can be written in the form . with kpc, and pc. Mike E. Prokhorov . Fri Jul 19 19:16:07 MSD 1996

Еще в разделе: (Показать все результаты (>408) - xray.sai.msu.ru/ )

• Space and velocity distributions
• Old neutron star distribution in the Galaxy
• Initial velocity

. SDPpred: a tool for prediction of amino acid residues . that determine differences in functional specificity of homologous proteins .

Еще в разделе: (Показать все результаты (>2369) - monkey.belozersky.msu.ru/ )

• About this project
• About authors ot this complex
• HTH3_species_distribution

... 5 import project . 6 import sequence . ... 19 * self.project -- project object, which the block belongs to . ... 22 * self.positions -- sorted list of positions of the project.alignment that . ... 34 def __init__ ( self , project , sequences = None , positions = None ): . ... 75 If more than one pdb chain for some sequence provided, consider all of them . ... 132 def ca_atoms ( self , sequence , pdb_chain ): . ... 136 def sequences_chains ( self ): . ... 145 sequences_chains = list ( self . ...

Еще в разделе: (Показать все результаты (>31364) - kodomo.fbb.msu.ru/ )

• allpy: ab9e2260a60a lib/block.py
• allpy: a016cad5f5a0 lib/block.py
• allpy: f6db5f284ee3 lib/block.py

... Gubkina 3, Moscow, 119991 Russia e-mail: johnnie_me@list.ru Distribution of genomic elements, i.e. segments of their increased or decreased density, may be related to DNA domains performing specific functions (e.g. CpG islands [1], clusters of transcription factor binding sites (TFBS) [2], or segments enriched or depleted in nucleosome binding sites [3]). ... Relative positions of conserved domains and nucleosomes in the proximal region of D.melanogaster even-skipped gene locus. ...

Еще в разделе: (Показать все результаты (>316) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/244.pdf
• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/214.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/156.pdf

Электронная библиотека Попечительского совета . ... Narkiewicz W. - Uniform Distribution Of Sequences Of Integers In Residue Classes . ... Название: Uniform Distribution Of Sequences Of Integers In Residue Classes . Автор: Narkiewicz W. Язык: . ... Sequence uniformly distributed mod N 1 . Sequence weakly uniformly distributed mod N 8 . ... Uniform distribution mod N 1 . Uniform distribution mod N, criterion 1 . ... Электронная библиотека попечительского совета мехмата МГУ , 2004-2016 . ...

Еще в разделе: (Показать все результаты (>12477) - lib.mexmat.ru/ )

• Fan Sh., Han W. - 0,1 distribution in the highest level sequences of primitive
• Gnedenko B.V., Kolmogorov A.N., Chung K.L. - Limit Distributions for Sums of
• Duistermaat J.J, Kolk J.A.C. - Distributions: theory and applications ::

... Stationary distribution for the Jacobi equation with a large random curvature parameter" . Illarionov E.A. A generalization of the results obtained previously for the case when the curvature parameter of the Jacobi equation is a random quantity distributed on a large or infinite interval is proposed. ... Keywords: stationary distribution, product of matrices, integral equation, Jacobi equation . ...

Еще в разделе: (Показать все результаты (>320) - num-meth.srcc.msu.ru/ )

• "Stationary distribution of product of matrices with random coefficients"
• Numerical modeling of conjugated point distribution along a geodesic with
• "Implementation of the lattice Boltzmann method without stored distribution

Mustela . On a taxonomic position of the weasel (Carnivora, Mustela ) from the Cheju Island (South Korea) . ... The weasel from Cheju Island (formerly в?' Quelpart Island), which is situated in Korean Strait south of the coast of South Korea, was described as a separate species Lutreola quelpartis Thomas, 1908. ... Abramov A.V. 2000b. The taxonomic status of the Japanese weasel, Mustela itatsi (Carnivora, Mustelidae) // Zoologicheskii Zhurnal. ... A Pictorial Guide to the Mammals of Japan. ...

Еще в разделе: (Показать все результаты (>1496) - zmmu.msu.ru/ )

• Russian Journal of Theriology
• The distributions of telomeric and ribosomal DNA on the chromosomes of two
• Temporal and spatial distribution of Rad51 protein in spermatocytes of the

Introduction to Gymnosperms Group of seed bearing plants that contain conifers, cycads, Ginkgo, and Gnetales. ... The 5 main lineages separated from each other during the late Carboniferous to late Triassic (311-212 mya) While many species such as Ginkgo biloba are living fossils,due to pulses of extinction and specialization most living gymnosperm species are much younger then though to be. ... Due to these climate changes older lineages of gymnosperms are mostly found in the southern hemisphere. ...

Еще в разделе: (Показать все результаты (>407) - herba.msu.ru/ )

Evalign . Evalign is a computerised evaluation method for protein sequence alignment algorithm. It compares computer alignments with structural alignments of protein sequences and tells how correct your sequence alignment program is. It gives additional information on the characteristics of different alignment algorithms and shows types specific failings in alignment. ... None . ... SAL Home | Other Scientific Fields | Chemistry, Biology Related . ... SAL@KachinaTech.COM . ...

Еще в разделе: (Показать все результаты (>2599) - www.sai.msu.su/ )

• SNe related preprints
• SAL- Other Scientific Fields - Chemistry, Biology Related - GRS
• The Network Time Protocol (NTP) Distribution

... Программа на сентябрь 2008 г. 24 сентября. H. Wakaki (Hiroshima University). An error bound for Box's chi-square type asymptotic expansion of Wilks' Lambda distribution. Abstract. An error bound for the Box's chi-square type asymptotic expansion of Wilks' Lambda distribution is derived. It is compared with an error bound for the high-dimensional Edgeworth expansion. ... Convergence of Multinomial Goodness-of-fit Statistics to Chi-square Distribution. ...

Еще в разделе: (Показать все результаты (>88) - new.math.msu.su/ )

• http://new.math.msu.su/department/probab/bsk11_13.htm

Measurements of B р Xsl+l- and BрK(*) l+l- at Belle A. Ishikawa (KEK) 18, Aug, 2004 32 nd International Conference on High Energy Physics BICC, Beijing, China Introduction n bрs l+l Е Е Е Е - Е First observed by Belle in BрKll Proceed through penguin, Z penguin and W box diagrams Sensitive to new physics Sign of Wilson coeffient C7 as well as C9 and C10 can be obtained from q2 distribution and AFB(q 2). ... Four background sources Е Е Е Е dilepton events from continuum, mostly from charm events. ...

Еще в разделе: (Показать все результаты (>172) - nuclphys.sinp.msu.ru/ )

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>206) - www.genebee.msu.ru/ )

• GeneBee BLAST 2.2.8 Services
• GeneBee BLAST 2.2.22+ Services
• RNA secondary structure prediction

... Alternative core new atoms (%) . ... An alignment of a set of structures is a set of positions , to each position some atoms from different structures correspond. ... Geometrical core of a set of structures is a subset of alignment positions those atoms are disposed similarly in all structures. ... For any two positions included into geometrical core, the distances between CA atoms of those positions in all structures may differ not more than the value of the parameter "Distance spreading". ...

Еще в разделе: (Показать все результаты (>6983) - mouse.belozersky.msu.ru/ )

• SVETKA, a program for multiple sequence alignments analysis

... DESCRIPTION= Probabilistic Consistency-based Multiple Alignment of Amino Acid Sequences HOMEPAGE= http :// probcons.stanford.edu / SRC_URI= http :// probcons.stanford.edu /${ MY_P }.tar.gz LICENSE = public-domain SLOT= 0 KEYWORDS= amd64 x86 ~amd64-linux ~x86-linux IUSE= # Gnuplot is explicitly runtime-only, it's run using system() RDEPEND= !sci-geosciences/gmt sci-visualization/ ...

Еще в разделе: (Показать все результаты (>47728) - mirror.msu.net/ )

• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/rfc933.txt
• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/pdfrfc/rfc933.txt.pdf
• http://mirror.msu.net/pub/gentoo-portage/sci-biology/t-coffee/t-coffee-11.00-r1.ebuild

... TWikiUpgradeGuide . ... Upgrade Requirements . Major Changes Compared to TWiki Release 01-Sep-2004 . ... TWiki-4.0.0 is a major new release. ... To upgrade from a release prior to TWiki Release 01-Sep-2004, start with TWiki:TWiki.UpgradingTWiki on TWiki.org . ... Create a new directory for your new installation: Let's call this distro/ . ... UpgradeTwiki creates the new installation in a new directory tree. ... Follow the installation instructions, and install the new release in a new directory. ...

Еще в разделе: (Показать все результаты (>34681) - dualopt1.cmm.msu.ru/ )

• %TOPICTITLE% (3 vs. 4) - TWiki
• ManagingWebs - TWiki - TWiki

Analysis of the ANTARES data for SN neutrino detection V. Kulikovskiy (MSU / INFN Genova) Hit counts in the detector. The number of hits ( hit counts ) in a time slice (104.8 ms) is used (this information is stored in each run) Mean number of hit counts in one PMT is ~5500 (corresponds to ~55 kHz) Expected number of hits from SN in 100ms is 11.6 ( 550 0) Bioluminescence bursts should be excluded Bioluminescence cut We have collected distributions of hit counts for each ...

Еще в разделе: (Показать все результаты (>14) - antares.sinp.msu.ru/ )

• http://antares.sinp.msu.ru/docs/2010_Amsterdam_Kulikovskiy.pdf
• http://antares.sinp.msu.ru/docs/INFN%20-%20Paper%203.pdf

Formatrpsdb: Build databases for RPS Blast Introduction ------------ Formatrpsdb is a utility that converts a collection of input sequences into a database suitable for use with Reverse Position Specific (RPS) Blast. Each input sequence, together with its position-specific scoring matrix (PSSM), is ASN.1 encoded into a PssmWithParameters (or 'scoremat') object and resides in a separate file. ... An RPS Blast database consists of two groups of files. ...

Еще в разделе: (Показать все результаты (>4614) - kodomo.cmm.msu.ru/ )

• http://kodomo.cmm.msu.su/FBB/year_04/doc/BLAST_help/impala.html
• http://kodomo.cmm.msu.su/FBB/year_04/doc/BLAST_help/index.html
• http://kodomo.cmm.msu.su/FBB/year_04/doc/term3/fasta_man.txt

Next: What UUCP Needs to Up: UUCP Configuration Files Previous: UUCP Configuration Files . ... It is really a hairy subject, and the sometimes terse format of the configuration files doesn't make things easier (although the Taylor format is almost easy reading compared to the older formats in HDB or Version-2). ... Some distributions contain UUCP binaries that have support for both HDB and Taylor configuration enabled, and use different subdirectories for each configuration file set. ...

Еще в разделе: (Показать все результаты (>367) - itpm.msu.su/ )

• Extracting the binary distribution
• Mixing and Matching Binary Distributions
• MySQL Reference Manual for version 3.23.10-alpha. - H Description of MySQL

... Minimal size of Clud clusters (residues) . ... An alignment of a set of structures is a set of positions , to each position some atoms from different structures correspond. ... Hydrophobic cluster of a single protein structure is a separated pool of nonpolar atoms. Usually there is the biggest cluster in the protein called hydrophobic core. ... ConClus program is able to detect of conservative hydrophobic clusters for a family of related protein domains or just for a set of aligned proteins. ...

Еще в разделе: (Показать все результаты (>27) - mouse.genebee.msu.ru/ )

• Nhunt: program for nucleic acid sequence similarity search