1. APOD Index - Solar System: Comets: Hyakutake
Archive | Index | ... Index sorted by date APOD appeared. ... Comet Hyakutake and a Solar Flare . Comet Hyakutake Passes the Sun . The Tails of Comet Hyakutake . Comet Hyakutake and a Cactus . The Sun Sets on Comet Hyakutake . Comet Hyakutake on a Starry Night . ... The Rotating Jets of Comet Hyakutake . ... Comet Hyakutake's Closest Approach . Comet Hyakutake's Past and Future . ... Near Comet Hyakutake's Nucleus . ... Comet Hyakutake's Orbit . ... NASA Technical Rep.: ...
[
]
http://www.sai.msu.su/apod/lib/hyakutake.html -- 4.5 -- 21.12.2007
:
(
(>189) - www.sai.msu.su/ )
2. Comet Hyakutake Passes the Earth
... McCollough's MPEG Movie of Comet Hyakutake taken March 23 Explanation: This picture of Comet Hyakutake taken the night of March 21/22 in Illinois, USA shows the enormous tail that has already developed. ... As the comet moves into the inner Solar System , it will pass the Earth at about 40 times the distance of our Moon . ... Latest Comet Hyakutake images: JPL , Crni Vrh Observatory, Slovenia , Fayetteville Observer-Times , NASA's Night of the Comet . ... Publications with keywords: comet Hyakutake ...
[
]
http://www.astronet.ru/db/xware/msg/1159958 -- 15.9 -- 24.08.2002
:
(
(>4245) - www.astronet.ru/ )
3. APOD: May 1, 1996 - Comet Hyakutake and a Cactus
... May 1, 1996 . Comet Hyakutake and a Cactus . ... Today Comet Hyakutake reaches its closest approach to the Sun . Comet Hyakutake is now at its intrinsic brightest, but because of its distance from the Earth , it will appear less bright to us than it did during its closest approach to the Earth in late March. ... Latest Comet Hyakutake images: APOD Hyakutake Archive , JPL , Fayetteville Observer-Times , NASA's Night of the Comet , ICSTARS , Jerry Lodriguss , ScienceWeb , Crni Vrh Obs. ...
[
]
http://www.sai.msu.su/apod/ap960501.html -- 5.2 -- 02.10.2012
:
(
(>2) - www.arcetri.astro.it/ )
4. Hyakutake 1996 .
Hyakutake 1996 . , . (~20 - ). ... -24 (35/2), f/2.8 , Kodak Tmax p3200 , Tmax . ( -1 ) "". Adobe Photoshop . ...
[
]
http://astrometric.sai.msu.ru/stump/html/3_125.html -- 3.2 -- 17.08.2004
:
(
(>6) - astrometric.sai.msu.ru/ )
5. http://comet.sai.msu.ru/~monstr/article/hyak.html
... , . 16 16 1996 -6 (D=250 mm F=945 mm =5 ) 1-, ZP-3, ZU-21. ... 18 25 1996 - ST-8 (1530*1020 ), -1. ...
[
]
http://comet.sai.msu.ru/~monstr/article/hyak.html -- 2.9 -- 14.05.1997
:
(
(>150) - comet.sai.msu.ru/ )
7. DELTA
Gnumeric . Prev . Next . ... , #VALUE!. Excel. ... EXACT , GESTEP . ... DEGREES . ... DEVSQ ...
[
]
http://uneex.mithril.cs.msu.su/static/GnumericDoc_ru/r3178.html -- 3.9 -- 26.09.2011
[
]
http://uneex.lorien.cs.msu.su/static/GnumericDoc_ru/r3178.html -- 3.9 -- 26.09.2011
:
(
(>10) - uneex.lorien.cs.msu.su/ )
8. : Delta - Public forum of MSU united student networks
... -General- Common Current University Society Study Diaspora FAQ Real Estate -Technical- Development Hard&Soft Network Mobile -Market- Market Services Job -Hobby- Behemoth Health Love&Sex Media Games Auto&Moto Sport Hobby Flood Zone -Servant- Alternative Forums Forum -Garbage- Revolution Garbage Private . : Delta . ... Common . ... msu_td . ... Delta . ...
[
]
http://www.snto-msu.net/ratingdetails.php?username=Delta&showlite= -- 21.8 -- 10.04.2016
:
(
(>309) - www.snto-msu.net/ )
10. W Delta Z - - Kinfo.ru
... -> -> W Delta Z . ... . ... W Delta Z . ... 2007 . ... Tom Shankland . ... Tom Hardy . ... Peter Ballance . ... Alibe Parsons . ... Barbara Adair . ... Selma Blair . ...
[
]
http://kinfo.ru/Movie/02562774-9c3f-4a07-abc7-00a26b966329 -- 8.6 -- 11.04.2016
11. Index of /pub/gentoo-portage/app-portage/emerge-delta-webrsync/
... 2016-Jan-25 18:19:21 . ... application/octet-stream . ... 2015-Aug-24 13:49:19 . ... text/plain . ... text/xml . ...
[
]
http://mirror.msu.net/pub/gentoo-portage/app-portage/emerge-delta-webrsync/ -- 4.0 -- 10.04.2016
:
(
(>770) - mirror.msu.net/ )
12. , $\Delta$ ($\Delta$-operation) ::
. . - . . Ex Libris Wanted . . . . . . . . . . . . - . 303, 322 . , 2004-2016 . | |
[
]
http://lib.mexmat.ru/showsubject/546844 -- 11.6 -- 13.04.2016
:
(
(>785) - lib.mexmat.ru/ )
13. http://kodomo.fbb.msu.ru/~alex2308/align/delta_aligned.fasta
sp|P0C6M3|LHDAG_HDVP1 Large delta antigen ; MSQTVARLT-SKEREEILEQWVEERKNRRKLEKDLRRANKKIKKLEDENPWLGNVVGLL- RRKKDEDGAPPAKRPRQETMEVDSGPGRKPKARGFTDQERRDHRRRKALENKKKQLAGGG KHLSQEEEEELRRLARDDDERERRTAGPRPGGVNPMDGPPRGAPGGGFVPSLQGVPESPF SRTGEGIDIRGTQQFPWYGFTPPPPGYYWVPGCTQQ sp|Q81842|SHDAG_HDVP1 Small delta ...
[
]
http://kodomo.fbb.msu.ru/~alex2308/align/delta_aligned.fasta -- 9.8 -- 20.04.2009
[
]
http://kodomo.cmm.msu.ru/~lesya/images/delta_muscle.fasta -- 9.8 -- 24.05.2009
:
(
(>1062) - kodomo.cmm.msu.ru/ )
14. jo0017
... Hour of right ascension (alpha, h), B1950.0 6. ... Degree of declination (delta, deg), B1950.0 9. ... Unsertainty in Delta(delta), arcsec --------------------------------------------------------------------------------------------- Year alpha delta alpha delta Unsertainties N month B1950.0 B1950.0 J2000.0 J2000.0 D(alpha) D(delta) sat day h m s deg ' '' h m s deg ' '' cos(delta) with decimals arcsec arcsec --------------------------------------------------------------------------------------------- ...
[
]
http://www.sai.msu.ru/neb/nss/OBS_COLL/J/jo0017.html -- 4.5 -- 22.06.2004
[
]
http://lnfm1.sai.msu.ru/neb/nss/OBS_COLL/J/jo0017.html -- 4.5 -- 22.06.2004
:
(
(>248) - lnfm1.sai.msu.ru/ )
15. DELTA ABRASIMET
.
[
]
http://www.chemport.ru/labequipment_products1052.html -- 13.8 -- 11.04.2016
:
(
(>11) - www.chemport.ru/ )
17. http://higeom.math.msu.su/people/dynnikov/papers/dy-umn02.ps
Lambda ########### f : X \Theta X ! ... f \Gamma1 = ffi f ffi , ### (a; b; c; d) = (\Gammaa; b; \Gammac; d). ##############. ##### ############ ##### #########, ### ########### f r (a; b; c; d) = i a + ab + bc; bcd bc + a(1 + b)(1 + d) ; acd a + c + ad ; bc + a(1 + b)(1 + d) c j ; (3) ########## ## f ####### ######## +; \Gamma; max ## \Delta; =; + ##############, ######## ############ ####-- ######## ## R 2 + . ... Quantum groups (Leningrad, 1990), 1--8, Lecture Notes in Math., ... Math. ...
[
]
http://higeom.math.msu.su/people/dynnikov/papers/dy-umn02.ps -- 138.0 -- 22.02.2005
:
(
(>20) - higeom.math.msu.su/ )
18. MAREZIO M. - | -
: \ . ... . ... Capponi J.J. , Kopnin E.M. , Loureiro S.M. , Antipov E.V. , Gautier E. , Chaillout C. , Souletie B. , Brunner M. , Tholence J.L. , Marezio M. Physica C , 256, ? 1-2, . 1-7 DOI . ... 3-4, . 401-406 DOI . ... 2, . 406-409 DOI . ... 3-4, . 265-272 DOI . ... 5130, . 97-99 DOI . ...
[
]
http://istina.msu.ru/workers/455271/ -- 44.4 -- 10.04.2016
:
(
(>333) - istina.msu.ru/ )
19. allpy: 0c3c1856113a
... allpy/base.py allpy/pdb.py . ... allpy/base.py . ... allpy/pdb.py . ... 1.1 --- a/ allpy /base.py Thu Dec 16 20:45:57 2010 +0300 1.2 +++ b/ allpy /base.py Thu Dec 16 20:47:09 2010 +0300 1.3 @@ -380,61 +380,6 @@ 1.4 string = ''.join([m.type.code1 if m else '-' for m in block_monomers]) 1.5 save_fasta(out_file, string, sequence .name, sequence .description, long_line) 1.6 1.7 - def geometrical_cores(self, max_ delta =config. delta , 1.8 - timeout =config. timeout , minsize=config.minsize, 1.9 - ...
[
]
http://kodomo.fbb.msu.ru/hg/allpy/rev/0c3c1856113a -- 18.6 -- 01.10.2012
:
(
(>2523) - kodomo.fbb.msu.ru/ )
20. > !
... : ! > > . Delta . ... 10- 11- . ... , ? . ... , ? ... , , "" . ...
[
]
http://wasp.phys.msu.ru/forum/lofiversion/index.php?t2718.html -- 9.3 -- 11.04.2016
:
(
(>128) - wasp.phys.msu.ru/ )