. Словарь . Дополнительные ссылки . Справочные материалы . Об авторах

Еще в разделе: (Показать все результаты (>1108) - crydee.sai.msu.ru/ )

• Heliophysics, Internal structure and seismology
• Эволюция звезд (Stellar evolution)

Электронная библиотека Попечительского совета . ... Olsen K.H. - Continental Rifts: Evolution, Structure, Tectonics . ... Название: Continental Rifts: Evolution, Structure, Tectonics . ... Continental Rifts: Evolution, Structure, Tectonics presents an overview of the present state of understanding and knowledge of the processes of continental rifting from a multidisciplinary, lithospheric scale perspective. ... Электронная библиотека попечительского совета мехмата МГУ , 2004-2016 . ...

Еще в разделе: (Показать все результаты (>15074) - lib.mexmat.ru/ )

• Jong R.S. - Island Universes: Structure and Evolution of Disk Galaxies ::
• Swanson Z., Srinidhi B., Seetharaman A. - Capital Structure Paradigm: Evolution
• van der Hilst R.D. - Composition, Deep Structure and Evolution of Continents ::

An international conference entitled "Flowers: diversity, development and evolution" will be held at the Institute of Systematic Botany, University of Zurich, Zurich, Switzerland, 5-7 July 2002. The conference will focus on the structure of flowers, placing them in context with their evolutionary origin, function, development and genetic control. ... Flowers: diversity, development and evolution 5-7 July, 2002 Institute of Systematic Botany, The University of Zurich, Zurich, Switzerland . ...

Еще в разделе: (Показать все результаты (>216) - herba.msu.ru/ )

• Plant evolution on the small islands of the Russian White Sea

... Earth . Earth, and planetary tectonics . ... Earth, tectonic features of . ... Effective elastic thickness of a plate . ... Elastic deformation . Elastic deformation mechanisms . Elastic deformation, definition of . Elastic deformation, experimental fractures and . ... Elasticity . ... Elasticity, elastic behavior . ... En echelon . En echelon fractures . ... Extension . ... Extension fractures, fracture plane for . ... Extension fractures, vs. shear fractures . ... Extensional . ...

Еще в разделе: (Показать все результаты (>935) - geo.web.ru/ )

• Ссылки на сейсмотомографические сайты
• Informal geological society (RSG SG )

... 2011 Evolution of Prokaryotic Genes by Shift of Stop Codons . ... в журнале Journal of Molecular Evolution , издательство Springer Verlag (Germany) , том 72, ? ... Mardanov A.V. , Ravin N.V. , Kuznetsov B.B. , Samigullin T.H. , Antonov A.S. , Kolganova T.V. , Skyabin K.G. в журнале Journal of Molecular Evolution , издательство Springer Verlag (Germany) , том 66, ? ... Artamonova I.I. , Gelfand M.S. в журнале Journal of Molecular Evolution , издательство Springer Verlag (Germany) , том 59, ? ...

Еще в разделе: (Показать все результаты (>4857) - istina.msu.ru/ )

• Trends in Ecology and Evolution - журнал | ИСТИНА - Интеллектуальная Система
• Evolution and Human Behavior - журнал | ИСТИНА - Интеллектуальная Система
• Molecular Biology and Evolution - журнал | ИСТИНА - Интеллектуальная Система

... On Some Class of Factorized Dynamical Systems and Their Integrability . ... There is studied the algebraic structure of a class of operatorial evolution equations factorizing standard Lax type integrable flows on the adjoint space to a Lie algebra of pseudo-differential operators. We found the corresponding Poisson structure on the corresponding subgroup Lie, constructed an infinite hierarchy of conservation laws. ...

Еще в разделе: (Показать все результаты (>258) - acs366.phys.msu.su/ )

• AUTHOR : Fokin M
• Abstract (Invited)

Russian Interdisciplinary . Temporology Seminar: . ... Journals about time . ... EVOLUTION. ... March 18, Tuesday . ... NEW TENDENCIES IN THE THEORY OF BIOLOGICAL EVOLUTION". ... SELF-ORGANIZATION AND PROGRESSIVE EVOLUTION IN NATURAL PROCESSES". ... EVOLUTION AND DEVELOPMENT OF BIOLOGICAL SYSTEMS AS MACROKINETICS OF RAMIFIED CHAIN PROCESSES". ... The laws guiding ramified chain processes in chemical and physical systems are similar to those which are characteristic of biological developement. ...

Еще в разделе: (Показать все результаты (>510) - chronos.msu.ru/ )

• Laboratory-Division Quantum Electrodynamics of Self-Organizing Systems and

... При этом возможно перенесение из Evolution папок и адресной книги (частично). ... Копирование ваших папок из Evolution в Thunderbird (они имеют одинаковый внутренний формат) : . Ниже подразумевается, что вы НЕ переопределяли стандартное размещение папок TB (.thunderbird/*/Mail/"Local Folders") . ... copyEvolFolds2TB.sh . процедура более медленная, но со 100% гаратией] в TB в "Local Folders" вручную создайте все необходимые папки, перечисленные в makeEvolFoldList, а после этого копируйте : . ...

Еще в разделе: (Показать все результаты (>5) - lhe.sinp.msu.ru/ )

• How to migrate from Pine to Evolution

... A.V. Eliseev . ... V.V. Adushkin, A.V. Vityazev, D.O. Glazachev, G.V. Pechernikova . Exogenous factors in the evolution of the Earth. ... Cosmic rays as a factor of biospheric evolution . ... A.V. Yakushev, N.A. Churilin, V.S. Soina, A.G. Kudinova, E.A. Vorobyova, N.S. Mergelov . ...

Еще в разделе: (Показать все результаты (>75) - comet.sai.msu.ru/ )

• IAC, Evolution of Galaxies, Conference

. [ Войти ] . Главная -> Фильмы -> Dragonball Evolution . Пользователи . Демо . Деньги . Фильмы . Форум . Dragonball Evolution . Драконий жемчуг: Эволюция . США 2009 . отметить . Приключение . Фантастика . Триллер . Фэнтэзи . Боевик .

Еще в разделе: (Показать все результаты (>57) - kinfo.ru/ )

• X-Men: Evolution - Фильмы - Kinfo.ru
• Epoch II: Evolution - Фильмы - Kinfo.ru
• Underworld: Evolution - Фильмы - Kinfo.ru

RNA Tertiary Structure Modelling . ... Two steps to fold coarse-grained model of RNA tertiary structure . ... fill in RNA secondary structure form with CT format (also with pseudoknots); . ... push "Finish Step #1" button to obtain secondary and intermediate* structures. * intermediate structure is the structure with minimum of "free energy" contains formed helixes and stacking, but without tertiary interactions . RNA secondary structure form . ... some useful RNA secondary structure databases: . ...

Еще в разделе: (Показать все результаты (>30817) - dualopt1.cmm.msu.ru/ )

... Devitrification of glass with the cation ratio, corresponding to the {Bi2.18Sr2CaCu2Ox+0.4Sr1.7Ca1.3Al2O6} composition, was studied. ... Above 600 o C, Bi-2212 and (Sr,Ca)3Al2O6 formed simultaneously, so that at 750 o C, the two-phase composite Bi-2212 - (Sr,Ca)3Al2O6 was obtained that contained grains of the aluminate phase 0.03-0.3 micron in size. ...

Еще в разделе: (Показать все результаты (>806) - chem.msu.ru/ )

• PC Crystal Chemistry Analysis of Organic Crystal Structures
• Molecular Structure and Physicochemical Properties of Acetone-Chloroform...
• Supermolecular Structure on and Physico-chemical Properties of Liquid Systems.

... Для исследования была взята последовательность белка Malk_ecoli . ... Identities = 214/326 (65%), Positives = 257/326 (78%), Gaps = 13/326 (3%) Query 1 LRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGA 60 LR IAGLE ITSGDLFIGE+RMND P++RGVGMVFQSYALYPHL++ +NMSFGLKL+ A Sbjct 46 LRCIAGLEDITSGDLFIGEQRMNDVEPSKRGVGMVFQSYALYPHLNLYDNMSFGLKLSKA 105 Query 61 KKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLD 120 K I +RV+ AE+LQL+HLLDR+PKALSGGQRQRVAIGRTLV++P+VFLLDEPLSNLD ...

Еще в разделе: (Показать все результаты (>2200) - kodomo.cmm.msu.ru/ )

• Practice1(evolution)
• evolution
• Gene Evolution Reconstruction

... The Evolution of the Russian Tax System in the 19thcentury, . ... Ezhegodnik (Economic Hystory. ... 2002 , Moscow: ROSSPEN, 2003, p.345-383. ... The article deals with the history of the taxes of the Russian empire in the 19th century. ... Despite of the lag with the European model which consisted in the absence of income taxation, the Russian tax system had provided the budget with monetary resources, that were necessary for the financial stability of the Empire. ...

Еще в разделе: (Показать все результаты (>201) - hist.msu.ru/ )

• Project "The Labour Relations Evolution in Russian Industries"

... II « » Symposium "Big History and Global Evolution" « : , , , » ( ) "Big History and Global Evolution" Scientific School for Youth "Historical globalistics: historical evolution, the present and forecast scenarios of global networks, global processes and institutions of global scale, and role of Russia and BRICS" (supported by RSCF) : .. ... 21 » International Scientific Symposium on Sustainable Development "Global Development: local conflict and challenges during 21st century : .. ...

Еще в разделе: (Показать все результаты (>71) - fgp.msu.ru/ )

... Supercomputing Technologies in Science, Education and Industry Almanac Series . ... DRIVER: To develop a model of the interstellar hydrogen distribution in the heliosphere. To apply this model for the analysis of experimental data from different spacecraft. ... The results of the simulations of the formation and evolution of molecular clouds can be used as initial conditions for the current star formation in galaxies. ... Research Computing Center (RCC) of Lomonosov Moscow State University . ...

Еще в разделе: (Показать все результаты (>70) - hpc.msu.ru/ )

• APPLICATIONS: Inorganic Chemistry | Moscow University Supercomputing Center
• APPLICATIONS: Plasma Physics | Moscow University Supercomputing Center
• APPLICATIONS: Geology | Moscow University Supercomputing Center

... TITLE . ... Abe K. On the equivariant diffeomorphism group of a smooth G-manifold and its application . Akhmetjev P. M. Cyclic structures on self-intersections of skew-framed immersed manifolds . ... Balashchenko V. V. Canonical structures on generalized symmetric spaces and Solovyov's formula . ... Bokan N. Curvature symmetries of manifolds with Grassman structure . ... Ershov A. V. Some homotopic invariants related to algebra bundles . ... Skopenkov A. B. Inertia groups of smooth embeddings . ...

Еще в разделе: (Показать все результаты (>49) - dfgm.math.msu.su/ )

. Structure of loops for many protein families change gradually in evolution. %Id = 73% %Id = 53% %Id = 26% . Evolutionary plasticity of loops ( bloop ) is higher than EP of cores ( bcore)

Еще в разделе: (Показать все результаты (>45) - ecology.genebee.msu.ru/ )

... research . ... I'm a postdoc in the group of Mathematical Modelling , Institute for Chemistry and Biology of the Marine Environment (ICBM), . University of Oldenburg, 26129 Oldenburg, Germany . ... a.ryabov@icbm.de . ... Research Associate . ... Nonlinear Dynamics Group . ... Nonlinear Dynamics & Chaos Group . Moscow State University . ... Ph.D. in Nonlinear Dynamics, Moscow State University . ... Diploma work in Statistical Physics, Moscow State University . ... б©2009 Ryabov Alexey | ...

Еще в разделе: (Показать все результаты (>64) - chaos.phys.msu.ru/ )

• Alexey Ryabov. Research

... Algorithm & . Format requirements . ... SDPsite is a tool for identification of protein active and other functional sites, based on spatial clustering of SDPs (specificity-determining positions, described here ) with CPs (conserved positions). ... Mapping predictied positions onto structure and construction of the best cluster . ... The input data of the algorithm are a multiple protein alignment divided into specificity groups . ... is called statistical significance of the set of k* positions . ...

Еще в разделе: (Показать все результаты (>142) - bioinf.fbb.msu.ru/ )

• SDPsite
• SDPsite - PF01399
• SDPsite - PF01206