... Fixed initial value for snake.Rule.direction . ... 8 class Cell ( object ): . 9 def __init__ ( self , x , y , canvas = None ): . ... type = 'empty' . ... 18 offset = ( self . ... create_rectangle ( offset [ 0 ], offset [ 1 ], offset [ 0 ] + self . x * field_size / 21.0 , offset [ 1 ] + self . ... 21 pass . ... 83 def move_snake ( self , snake ): . ... 98 dir_cell = self . ... type == 'tail' and dir_cell . ... 110 dir_cell = self . ... 159 dir_cell = self . ... type == 'empty' or ( dir_cell . ...

Еще в разделе: (Показать все результаты (>19333) - kodomo.fbb.msu.ru/ )

• snake: bc310be50e73 engine.py
• snake: c68b54a43501 engine.py
• snake: 836ce89ecc91 engine.py

... Atributes: - 'x' - absciss of the cell in field - 'y' - ordinate of the cell in field - 'canvas' - Widget the cell belongs to - ' snake ' - snake the cell belongs to, possible values: snake None 'my' \ 'enemy' / for patterns only - 'type' - type of the cell , possible values: 'empty' 'wall' 'body' 'head' 'tail' 'any' } for patterns only 'void' } for cells out of the field def __init__( ...

Еще в разделе: (Показать все результаты (>2413) - kodomo.cmm.msu.ru/ )

• http://kodomo.cmm.msu.su/trac/snake/browser/engine.py?rev=164%3Ade9d0b9071da&format=txt
• http://kodomo.cmm.msu.su/trac/snake/browser/engine.py?rev=0cf4e42c75a1587e0c447f6d5a0d1e2656835402&format=txt
• http://kodomo.cmm.msu.su/trac/snake/browser/engine.py?rev=156%3A7a4853ff834f&format=txt

. Press the ESC key to enter command mode before using these commands. To search Do this ... forward for a pattern / pattern <RETURN> backward for a pattern ? pattern <RETURN> repeat previous search n repeat previous search in N reverse direction .

Еще в разделе: (Показать все результаты (>47) - comet.sai.msu.ru/ )

• vi Reference

Выберите категорию обращения: Общие вопросы Отчеты Рейтинги Диссертационные советы Конкурсы Ввод данных Структура организаций Пользователи Проблемы с регистрацией\входом в систему . ... Войти в систему . ... Quesniaux VF , Jacobs M. , Allie N. , Grivennikov S. , Nedospasov SA , Garcia I. , Olleros ML , Shebzukhov Y. , Kuprash D. , Vasseur V. , Rose S. , Court N. , Vacher R. , Ryffel B. в журнале Current directions in autoimmunity , издательство S. Karger AG (Switzerland) , том 11, с. 157-179 DOI . ...

Еще в разделе: (Показать все результаты (>503) - istina.msu.ru/ )

• Strategic Direction - журнал | ИСТИНА - Интеллектуальная Система Тематического
• Current Directions in Psychological Science - журнал | ИСТИНА -
• Pattern Recognition and Image Analysis - журнал | ИСТИНА - Интеллектуальная

... The Laboratory of Programming Technologies was established in 2001. The Laboratory's team consists of collaborators and graduate students of Computer System Automation Department that work under supervision of Professor Igor Mashechkin. ... series of works for research and development of multi-functional cross-programming system. ... Presently the main scientific direction of the Laboratory is research and development of algorithms and methods for creating data mining software. ...

Еще в разделе: (Показать все результаты (>122) - en.cs.msu.ru/ )

• Laboratory of Programming Technologies | CMC MSU
• Laboratory of Mathematical Methods of Image Processing
• Information for foreigners who wish to study at our Faculty

Institute for Information Transmission Problems . IITP RAS was founded in 1961. At present basic direction of researches are the information theory and applied mathematics, computer and communication sciences in technique, management, nature, language and living systems. ... Now there are 9 members and corresponding members of Russian Academy of Sciences, 205 full professors and doctor of sciences. ...

Еще в разделе: (Показать все результаты (>150) - geo.web.ru/ )

• http://geo.web.ru/COMPASS/team.html
• Dictionary_R
• Dictionary_D

. Album : asv-album :: Travels to distant places and countries :: 1998/05 Boston (USA) :: 2 MIT . Up . << Prev . View from the bridge (downtown direction) . Next >> . Powered by album tool a MarginalHack written by David on Tue Jun 23 14:46:40 2015 .

Еще в разделе: (Показать все результаты (>1031) - crydee.sai.msu.ru/ )

• Long description for background pattern

... unknown) Pattern Modifiers -- Describes possible modifiers in regex patterns . ... If this modifier is set, letters in the pattern match both upper and lower case letters. m (PCRE_MULTILINE) . By default, PCRE treats the subject string as consisting of a single "line" of characters (even if it actually contains several newlines). ... If there are no "\n" characters in a subject string, or no occurrences of ^ or $ in a pattern, setting this modifier has no effect. s (PCRE_DOTALL) . ...

Еще в разделе: (Показать все результаты (>58) - oit.cmc.msu.ru/ )

• pdf_begin_pattern
• pdf_end_pattern
• preg_replace

. [ Войти ] . Главная -> Фильмы -> No Direction Home: Bob Dylan . Пользователи . Демо . Деньги . Фильмы . Форум . No Direction Home: Bob Dylan . Япония - США - Великобритания 2005 . отметить . Документальный . Исторический . Музыкальный . Martin Scorsese . Liam Clancy . Allen Ginsberg . Bruce Langhorne . John Cohen . Dick Kangas . Mitch Miller . Paul Nelson . Bob Dylan . Mark Spoelstra . Tony Glover . Suze Rotolo . Izzy Young . B.J. Rolfzen . Maria Muldaur . Dave Van Ronk .

Еще в разделе: (Показать все результаты (>16) - kinfo.ru/ )

• Patterns - Фильмы - Kinfo.ru
• Patterns [1956] - Фильм - Фильмы - Kinfo.ru

... from designing patterns to sewing to wearing . ... cheap the north face . ... win 7 ultimate product key Windows 8 key windows 7 key win 7 key windows 7 pro product key win 7 pro product key windows 7 activation key windows 7 ultimate product key windows 7 ultimate serial key windows 7 key online win 7 ultimate key win 7 serial keys Win 7 ultimate key Win 7 ultimate product key windows 7 key sale win 7 ultimate product Key Windows 7 key ultimate win 7 ultimate ...

Еще в разделе: (Показать все результаты (>22) - elana.sinp.msu.ru/ )

• ralph lauren s | С Днем Победы!

Запись фильма . Запись фильма в программе WinView/32 . Версия 2.2.1.10 . 1998, Princeton Instruments Inc . ... верхнее положение - синхронизирован с камерой . среднее положение - закрыт . нижнее положение - открыт . Настройки программы для записи фильма . Experimental Setup . ... Number of images (число кадров фильма) ? ... CCD readout use region of interest . Accumulation 1 . ... overwrite/append append to . 3) ROI setup . ... end, end x/4 . ...

Еще в разделе: (Показать все результаты (>27) - cellmotility.genebee.msu.ru/ )

... Ashford C., Gauthier P. - OSS design patterns. A pattern approach to the design of telecommunications management systems . ... Название: OSS design patterns. ... Авторы: Ashford C., Gauthier P. Аннотация: . This book advocates a pattern-based approach to the design of interfaces to Operations Support Systems (OSSs) to reduce the cost of delivering telecommunications management solutions. OSSs are the large servers that host the OSS applications that manage telecommunications services. ...

Еще в разделе: (Показать все результаты (>1676) - lib.mexmat.ru/ )

• Horne Clare E. - Geometric Symmetry in Patterns and Tilings :: Электронная
• Friedman M., Kandel A. - Introduction to pattern recognition :: Электронная
• Kircher M., Jain P. - Pattern-Oriented Software Architecture: Patterns for

... Video tracking and behavior segmentation of laboratory rodents. Pattern Recognition and Image Analysis . ...

Еще в разделе: (Показать все результаты (>108) - graphics.cs.msu.ru/ )

• High-Quality Algorithm for Bayer Pattern Interpolation | Graphics and Media Lab
• High-Quality Algorithm for Bayer Pattern Interpolation | Лаборатория

... If _callback is set, that means the caller wants results as soon as they are ready. =_callback_ should be set to a reference to a function which takes _cbdata as the first parameter and remaining parameters the same as 'print'. ... Otherwise the result is a string containing the rendered search results. ... Parse the arguments to a $formfield specification and extract the relevant formfield from the given meta data. args string containing name of form field . ...

Еще в разделе: (Показать все результаты (>32985) - dualopt1.cmm.msu.ru/ )

• TWikiSearchDotPm - TWiki - TWiki
• %TOPICTITLE% (2 vs. 3) - TWiki
• FilterPlugin - TWiki - TWiki - (printable)

... Screening pattern or alignment against protein databank . ... Protein databanks . SWISSPROT protein databank PDB: Biopolymer 3D structures . ... Pattern Alignment . ... Pattern (or alignment) . Pattern example 1: . ... Alignment example: . FA9_CAVPO GPHVTEVEGTNFLTGIISWGEE-CAMKGKYGIYTKVSRYVNW- FA9_PIG GPHVTEVEGTSFLTGIISWGEE-CAVKGKYGIYTKVSRYVNW- KAG_PIG GPLICNGM----WQGITSWGhtpCGSANKPSIYTKLIFYLDWI FA9_CAVPO FCAGFHEGGRDSCQGDSG FA9_PIG FCAGFHEGGKDSCLGDSG KAG_PIG LCAGYLPGGKDTCMGDSG . ...

Еще в разделе: (Показать все результаты (>62) - www.genebee.msu.ru/ )

• Screening of pattern or alignment against PROTEIN databank

... 2008 April 29 . Airplane Flight Patterns over the USA . ... Millions of people move about planet Earth by airplane every day. Hundreds of thousands of airplane flights take place over the US every day. ... The movie depicts flight patterns that occurred over a few days in 2005 March. ... Inspection of the movie shows that some times of the day are busier than others, indicating that flights leave some destinations at times that are convenient for travelers. ... About APOD | ...

Еще в разделе: (Показать все результаты (>313) - www.sai.msu.su/ )

• Creating a tileable pattern (00)
• CGFA- Joseph Peacock: The Pattern at Glendalough, Co. Wicklow
• Psql support

... Airplane Flight Patterns over the USA . ... Millions of people move about planet Earth by airplane every day. Hundreds of thousands of airplane flights take place over the US every day. ... The movie depicts flight patterns that occurred over a few days in 2005 March. ... Inspection of the movie shows that some times of the day are busier than others, indicating that flights leave some destinations at times that are convenient for travelers. ... NASA Official: Jay Norris. ...

Еще в разделе: (Показать все результаты (>567) - www.astronet.ru/ )

• Airplane Flight Patterns over the USA
• Cancri 55 e: Climate Patterns on a Lava World
• Астронет > Cancri 55 e: Climate Patterns on a Lava World

Evaluation of seed plants dispersed on either side of the tropical Atlantic, specifically South America and Africa, by wind and sea currents. ... From current data, it appears sea currents have been responsible for dispersals in either direction, while winds seem to play more of a role in transport from South America to Africa. ... It is more difficult to account for dispersal events inferred to have been due to winds blowing from South America to Africa. ...

Еще в разделе: (Показать все результаты (>72) - herba.msu.ru/ )

• Department of Mycology and Algology
• Plant Physiology Department

Б.П. Леонтьев . ... The very first problem is to select American Educational Materials (AEM), which are of high quality and wide nomenclature. ... Analysis undertaken in [ 1,3 ] revealed time patterns in this process. Time milestones are given to work out original educational and research products, which are based on redesign of AEM and on intercultural experience acquired during participation in JFDP. ...

Еще в разделе: (Показать все результаты (>20) - www.prof.msu.ru/ )

... We consider now change-points in different components of the frequency spectrum of typical EEG signal. ... Only few change-points in power are found in the initial EEG (unless a prominent alpha rhythm is present). ... Change-points in different frequency components of the EEG . ... Change-points in different types of the EEG alpha activity without substantial gradual changes . ... As can be seen from Fig. 7.3, the program reliably detected the change-points despite of such variety of signal patterns...

Еще в разделе: (Показать все результаты (>47) - brain.bio.msu.ru/ )