... All position indexes are counting from 1. + + import optparse + import sys + import os +from allpy import protein + +def main(): + alignment = protein. Alignment .from_fasta(open(options.in_file)) + if not options. begin : + options. begin = 1 + if not options. end : + options. end = len( alignment .columns) + columns = alignment .columns[options. begin -1:options. end ] + block = protein.Block.from_ ...

Еще в разделе: (Показать все результаты (>35040) - kodomo.fbb.msu.ru/ )

• allpy: bcc658a78e61 test/usecase2.py
• allpy: b556c96c6719 utils/realign_block.py
• allpy: b556c96c6719 utils/flush_left.py

... It interpolates the grid at the positions in the table and writes out the table with the interpolated values added as a new column. A bicubic [Default] or bilinear [ -Q ] interpolation is used, requiring boundary conditions at the limits of the region (see -L flag option). xyfile This is an ASCII [or binary, see -b ] file where the first 2 columns hold the (x,y) positions where the user wants to sample the 2-D data set. ... Default is 2 input columns]. -bo Selects binary output. ...

Еще в разделе: (Показать все результаты (>201) - xray.sai.msu.ru/ )

• http://xray.sai.msu.ru/~ivan/gmt/man/fitcircle.html
• http://xray.sai.msu.ru/~ivan/gmt/man/gmtselect.html
• http://xray.sai.msu.ru/~ivan/gmt/man/blockmode.html

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>140) - www.genebee.msu.ru/ )

• AliGraf - GeneBee Graphical Alignment Help
• Genebee Predicted Annotation - Advanced
• AliComp - GeneBee Alignments Comparison - Advanced

Homepage: http://desandro.com/resources/jquery-masonry . ... Masonry is a layout plugin for jQuery. ... Whereas floating arranges elements horizontally then vertically, Masonry arranges elements vertically then horizontally according to a grid. ... Depending on the layout, you?ll most likely need to specify one option. ... Lorem ipsum dolor sit amet, consectetuer adipiscing elit. ... This topic: System > JQueryPlugin > JQueryMasonry . ... Ideas, requests, problems regarding Foswiki? ...

Еще в разделе: (Показать все результаты (>4455) - wiki.cmc.msu.ru/ )

• PatternSkinTheme < System < Foswiki

... To run the <LAYER> version of the example, select: flower.htm . ... However, if the page had several layers with absolute positions, and you wanted to place another layer in a relative position to one of the existing layers, you could use inline JavaScript to calculate the value for LEFT or TOP . ... In this example, there is really no need to use inline JavaScript to position the last flower layer, since you could just let the TOP value default to its natural value, as in the other flower layers. ...

Еще в разделе: (Показать все результаты (>1393) - crydee.sai.msu.ru/ )

... О UNИX . ... HelpOnTables . ... Table Markup . ... General table layout and HTML like options . ... Line breaks within cells . ... Bulleted lists and other complex content within cells To create a table, start & end a new line using the table marker; two 'pipe' characters " || ... top left cell || top right cell || || bottom left cell || bottom right cell || ... Just use CSS-formatted styles and it will be inlined in the generated HTML tag. <style="..."> will put that style info into cell (td) html ...

Еще в разделе: (Показать все результаты (>443) - uneex.lorien.cs.msu.su/ )

• Informational Options
• License options
• Two handy options

... О UNИX . ... HelpOnTables . ... Table Markup . ... General table layout and HTML like options . ... Line breaks within cells . ... Bulleted lists and other complex content within cells To create a table, start & end a new line using the table marker; two 'pipe' characters " || ... top left cell || top right cell || || bottom left cell || bottom right cell || ... Just use CSS-formatted styles and it will be inlined in the generated HTML tag. <style="..."> will put that style info into cell (td) html ...

Еще в разделе: (Показать все результаты (>168) - uneex.mithril.cs.msu.su/ )

... E-mail . ... Этот e-mail защищен от спам-ботов. Для его просмотра в вашем браузере должна быть включена поддержка Java-script . ... Ведущий специалист . ... Главный специалист . ...

Еще в разделе: (Показать все результаты (>5) - www.ied.msu.ru/ )

... Usage ---+++ <nop>JavaScript API Configuring Masonry is fairly easy. ... For layouts with elements that span multiple widths: <verbatim class="js"> $('#wrapper').masonry({ columnWidth: 200 }); </verbatim> For layouts with elements that span the same width: <verbatim class="js"> $('#wrapper').masonry({ singleMode: true }); </verbatim> ---+++ Foswiki integration All containers classified as =jqMasonry= will be processed by this plugin. ... This topic: System > JQueryPlugin > JQueryMasonry . ...

Еще в разделе: (Показать все результаты (>1735) - wiki.cs.msu.ru/ )

... Algorithm & . ... SDPsite is a tool for identification of protein active and other functional sites, based on spatial clustering of SDPs (specificity-determining positions, described here ) with CPs (conserved positions). The analysis begins with a multiple alignment of a protein family. ... Predict SDPs only . Predict CPs only . Predict SDPs and CPs . Map a pre-identified list of SDPs and/or CPs onto a structure ...

Еще в разделе: (Показать все результаты (>141) - bioinf.fbb.msu.ru/ )

• SDPsite - Algorithm Format requirements
• Algorithm
• SDPlight

... Options . ... Possible options, which can be used in the command line to start LanHEP are: . ... InDir directory Set the default directory where to search files, which included by read and use statements. -tex LanHEP generates LaTeX files instead of CompHEP model tables. -frc If -tex option is set, forces LanHEP to split 4-fermion and 4-color vertices just as it is made for CompHEP files. -texLines num Set number of lines in LaTeX tables to num . ...

Еще в разделе: (Показать все результаты (>701) - theory.sinp.msu.ru/ )

• [Comphep-common] Privacy Options of mail list

... Alternative core new atoms (%) . ... An alignment of a set of structures is a set of positions , to each position some atoms from different structures correspond. ... Geometrical core of a set of structures is a subset of alignment positions those atoms are disposed similarly in all structures. ... For any two positions included into geometrical core, the distances between CA atoms of those positions in all structures may differ not more than the value of the parameter "Distance spreading". ...

Еще в разделе: (Показать все результаты (>6977) - mouse.belozersky.msu.ru/ )

• NPG-explorer

Электронная библиотека Попечительского совета . ... John C. Hull - Options, Futures, and Other Derivatives -Solution Manual . ... Название: Options, Futures, and Other Derivatives -Solution Manual . Автор: John C. Hull . ... Solutions to the Questions and Problems are in Options, Futures, and Other Derivatives 7e: Solutions Manual which is published by Pearson and can be purchased by students. ... Электронная библиотека попечительского совета мехмата МГУ , 2004-2016 . ...

Еще в разделе: (Показать все результаты (>4419) - lib.mexmat.ru/ )

• Henderson V., Hobson D.G. - Local time, Coupling and the Passport Option ::
• Mun J. - Real Options Analysis. Tools and Techniques for Valuing Strategic
• Shreve S.E. - Stochastic Calculus for Finance 1 :: Электронная библиотека

Title Author Key words Features of middle class positioning in Russian informational and analytical press Vladykina M.I. middle class, an image, a position, object of influence, social subject This paper analyzes the characteristics of the image and the position of the Russian middle class, reflected in the press. The results of the content analysis of newspaper articles about the middle class. Identified some options contradictory image of the Russian middle class in the newspaper. Abstract

Еще в разделе: (Показать все результаты (>22) - www.socio.msu.ru/ )

Option setting  Codon table: Universal Vertebrate mitochondria  Remove gaps, inframe stop codons : No Yes o Calculate KS and KA: No Yes (valid only if the input is a pair of sequences) (для того, чтобы получить значения KS и КА, необходимо в данном разделе отметить пункт Calculate KS and KA: Yes (valid only if the input is a pair of sequences))  Remove mismatches: (mismatched codons between protein and DNA) No ...

Еще в разделе: (Показать все результаты (>3772) - kodomo.cmm.msu.ru/ )

• http://kodomo.fbb.msu.ru/~alex2308/posled/infoseq.help
• http://kodomo.cmm.msu.su/FBB/year_04/doc/BLAST_help/impala.html
• http://kodomo.cmm.msu.ru/~jesus_crist/infoseq.help

... Les programmes d?enseignement . ... La page principale > Les programmes d?enseignement > . S?minaires options d??t? . ... le russe des affaires; . ... Les tudiants liront et analyseront des chef-d oeuvres de la po sie russe du ХIХ ХХ mes si cles; ils mettront les spectacles en sc ne et participeront galement aux mini-spectalces fond s sur la base de ce qu ils ont lu. ... Vous apprendrez le vocabulaire professionnel et les structures grammaticales, les plus communes dans le russe d affaires. ...

Еще в разделе: (Показать все результаты (>6) - www.cie.ru/ )

• Les programmes d?enseignement :: CEI

... bool printer_set_option ( resource handle, int option, mixed value) . ... PRINTER_MODE : specifies the type of data (text, raw or emf), value must be a string. ... PRINTER_PAPER_FORMAT : specifies the a predefined paper format, set value to PRINTER_FORMAT_CUSTOM if you want to specify a custom format with PRINTER_PAPER_WIDTH and PRINTER_PAPER_LENGTH. value can be one of the following constants. ... PRINTER_FORMAT_LETTER : specifies standard letter format (8 1/2- by 11-inches). ...

Еще в разделе: (Показать все результаты (>474) - oit.cmc.msu.ru/ )

• PHP Options&Information
• ftp_set_option
• xml_parser_set_option

... The first options file is /etc/ppp/options, which is always scanned when pppd starts up. ... It allows each user to specify her own set of default options. A sample /etc/ppp/options file might look like this: # Global options for pppd running on vlager.vbrew.com auth # require authentication usehostname # use local hostname for CHAP lock # use UUCP-style device locking domain vbrew.com # our domain name The first two of these options apply to authentication and will be explained below. ...

Еще в разделе: (Показать все результаты (>339) - itpm.msu.su/ )

• Kernel Options in 1.0 and Higher
• Link Control Options
• Kernel Options in 1.1.14 and Higher

... In some cases where memory space is at a premium, it is possible to tailor the configuration to remove such features as reference clock driver support, debugging support, and so forth. ... The following lines are used in this file: . ... The DEFS_LOCAL line defines global flags that apply to all machines. Ordinarily, the only flags included are the -DDEBUG , which includes the debugging code, and -DREFCLOCK , which includes basic reference clock support. ... D_INCLUDE_BSD_SOURCE . ...

Еще в разделе: (Показать все результаты (>1632) - www.sai.msu.su/ )

• Zen: Tsearch V2 in Brief
• Reference Clock Options
• xntpd - Network Time Protocol (NTP) daemon

. SDPpred: a tool for prediction of amino acid residues . that determine differences in functional specificity of homologous proteins .

Еще в разделе: (Показать все результаты (>394) - monkey.belozersky.msu.ru/ )

• About this project
• Example of supporting positions
• SDPpred