... help . ... 1.6 + 1.7 +All position indexes are counting from 1. 1.8 + 1.9 + import optparse 1.10 + import sys 1.11 + import os 1.12 +from allpy import protein 1.13 +from allpy .processors import Muscle 1.14 + 1.15 +def main(): 1.16 + alignment = protein. Alignment ().append_file(open(options.in_file)) 1.17 + if not options.begin: 1.18 + options.begin = 1 1.19 + if not options.end: 1.20 + options.end = len( alignment ...

Еще в разделе: (Показать все результаты (>113217) - kodomo.fbb.msu.ru/ )

• allpy: cd43d59c0dba
• allpy: 7d73604c8df6
• allpy: b556c96c6719 utils/realign_block.py

Importing ticket data = == Bugzilla == Ticket data can be imported from Bugzilla using the [http://trac.edgewall.org/browser/trunk/contrib/bugzilla2trac.py bugzilla2trac.py] script, available in the contrib/ directory of the Trac distribution. {{{ $ bugzilla2trac.py bugzilla2trac - Imports a bug database from Bugzilla into Trac. Usage: bugzilla2trac.py [options] Available Options: --db <MySQL dbname> - Bugzilla's database --tracenv /path/to/trac/env - full path to Trac db environment -h | ...

Еще в разделе: (Показать все результаты (>6063) - kodomo.cmm.msu.ru/ )

• TracImport тАУ Tanchiki
• Help: import
• petri_dish: 69a4724e7cac bacteria.py

You are here: Foswiki > System Web > JQueryPlugin > JQueryMasonry (revision 2) E dit A ttach . Homepage: http://desandro.com/resources/jquery-masonry . ... Masonry is a layout plugin for jQuery. ... Whereas floating arranges elements horizontally then vertically, Masonry arranges elements vertically then horizontally according to a grid. ... Depending on the layout, you?ll most likely need to specify one option. ... Lorem ipsum dolor sit amet, consectetuer adipiscing elit. ... System . ...

Еще в разделе: (Показать все результаты (>5007) - wiki.cmc.msu.ru/ )

... Les programmes d?enseignement . ... La page principale > Les programmes d?enseignement > . S?minaires options d??t? . ... le russe des affaires; . ... Les tudiants liront et analyseront des chef-d oeuvres de la po sie russe du ХIХ ХХ mes si cles; ils mettront les spectacles en sc ne et participeront galement aux mini-spectalces fond s sur la base de ce qu ils ont lu. ... Vous apprendrez le vocabulaire professionnel et les structures grammaticales, les plus communes dans le russe d affaires. ...

Еще в разделе: (Показать все результаты (>249) - www.cie.ru/ )

• Les programmes d?enseignement :: CEI

... It interpolates the grid at the positions in the table and writes out the table with the interpolated values added as a new column. A bicubic [Default] or bilinear [ -Q ] interpolation is used, requiring boundary conditions at the limits of the region (see -L flag option). xyfile This is an ASCII [or binary, see -b ] file where the first 2 columns hold the (x,y) positions where the user wants to sample the 2-D data set. ... Default is 2 input columns]. -bo Selects binary output. ...

Еще в разделе: (Показать все результаты (>188) - xray.sai.msu.ru/ )

• http://xray.sai.msu.ru/~ivan/gmt/man/fitcircle.html
• http://xray.sai.msu.ru/~ivan/gmt/man/blockmode.html
• http://xray.sai.msu.ru/~ivan/gmt/man/blockmedian.html

... Supposed to be # set in src_configure(). ... Output the resulting flag list (suitable # for an assignment to SCONSOPTS ). _ scons _clean_makeopts() { local new_makeopts=() debug-print-function ${FUNCNAME} ${@} if [[ ${#} -eq 0 ]]; then debug-print Using MAKEOPTS: [${MAKEOPTS}] set -- ${MAKEOPTS} else # unquote if necessary set -- ${*} fi # empty MAKEOPTS give out empty SCONSOPTS # thus, we do need to worry about the initial setup if [[ ${*} = ${_ SCONS _CACHE_MAKEOPTS} ]]; then ...

Еще в разделе: (Показать все результаты (>23992) - mirror.msu.net/ )

• http://mirror.msu.net/pub/gentoo-portage/sci-biology/snpfile/files/snpfile-2.0.1-gentoo.diff
• http://mirror.msu.net/pub/gentoo-portage/app-office/calligra/calligra-2.8.5.ebuild
• http://mirror.msu.net/pub/gentoo-portage/app-office/calligra/calligra-2.9.11.ebuild

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>143) - www.genebee.msu.ru/ )

• AliGraf - GeneBee Graphical Alignment Help
• AliComp - GeneBee Alignments Comparison - Advanced
• Genebee Predicted Annotation - Advanced

... E-mail . ... Этот e-mail защищен от спам-ботов. Для его просмотра в вашем браузере должна быть включена поддержка Java-script . ... Ведущий специалист . ... Главный специалист . ...

Еще в разделе: (Показать все результаты (>3) - www.ied.msu.ru/ )

... TWikiForms . ... Defining a Form Template . ... Form-based input in topics, with name/value pairs stored as Meta Data variables; choose one of multiple forms per web & topic . ... On upgrading from the previous TWiki, a Form Template topic has to be built for each web that used a Category Table, recreating the fields and values from the old twikicatitems.tmpl . ... The form topic name, fields and values are stored as TWikiMetaData - the order of the field/value pairs is the same as in the template. ...

Еще в разделе: (Показать все результаты (>37431) - dualopt1.cmm.msu.ru/ )

... Basic channels . ... To add new channel, You have to select one of the spectral operations from the Operations list, modify or set the operations parameters and select one (for unary operations) or two (for binary operations) parent spectral channels. ... Subset of parameters in parent channel parameters vector . ... Using the left mouse button, mark the speech frames in the recorded speech (white columns in the lower spectral window, corresponding to the parent channel of this speech detector). ...

Еще в разделе: (Показать все результаты (>36) - www.intsys.msu.ru/ )

• Usage
• Options dialog

... To run the <LAYER> version of the example, select: flower.htm . ... However, if the page had several layers with absolute positions, and you wanted to place another layer in a relative position to one of the existing layers, you could use inline JavaScript to calculate the value for LEFT or TOP . ... In this example, there is really no need to use inline JavaScript to position the last flower layer, since you could just let the TOP value default to its natural value, as in the other flower layers. ...

Еще в разделе: (Показать все результаты (>1521) - crydee.sai.msu.ru/ )

... О UNИX . ... HelpOnTables . ... Table Markup . ... General table layout and HTML like options . ... Line breaks within cells . ... Bulleted lists and other complex content within cells To create a table, start & end a new line using the table marker; two 'pipe' characters " || ... top left cell || top right cell || || bottom left cell || bottom right cell || ... Just use CSS-formatted styles and it will be inlined in the generated HTML tag. <style="..."> will put that style info into cell (td) html ...

Еще в разделе: (Показать все результаты (>546) - uneex.lorien.cs.msu.su/ )

• PspoMaterials/LibraryGnomeOrg_Evolution - UNИX
• HelpOnXapian - UNИX
• ab - Apache HTTP server benchmarking tool - Apache HTTP Server

... О UNИX . ... HelpOnTables . ... Table Markup . ... General table layout and HTML like options . ... Line breaks within cells . ... Bulleted lists and other complex content within cells To create a table, start & end a new line using the table marker; two 'pipe' characters " || ... top left cell || top right cell || || bottom left cell || bottom right cell || ... Just use CSS-formatted styles and it will be inlined in the generated HTML tag. <style="..."> will put that style info into cell (td) html ...

Еще в разделе: (Показать все результаты (>246) - uneex.mithril.cs.msu.su/ )

• PspoMaterials/LibraryGnomeOrg_Evolution - UNИX
• HelpOnXapian - UNИX
• HelpOnMoinCommand - UNИX

... Alternative core new atoms (%) . ... An alignment of a set of structures is a set of positions , to each position some atoms from different structures correspond. ... Geometrical core of a set of structures is a subset of alignment positions those atoms are disposed similarly in all structures. ... For any two positions included into geometrical core, the distances between CA atoms of those positions in all structures may differ not more than the value of the parameter "Distance spreading". ...

Еще в разделе: (Показать все результаты (>6980) - mouse.belozersky.msu.ru/ )

• NPG-explorer

... Usage ---+++ <nop>JavaScript API Configuring Masonry is fairly easy. ... For layouts with elements that span multiple widths: <verbatim class="js"> $('#wrapper').masonry({ columnWidth: 200 }); </verbatim> For layouts with elements that span the same width: <verbatim class="js"> $('#wrapper').masonry({ singleMode: true }); </verbatim> ---+++ Foswiki integration All containers classified as =jqMasonry= will be processed by this plugin. ... This topic: System > JQueryPlugin > JQueryMasonry . ...

Еще в разделе: (Показать все результаты (>1870) - wiki.cs.msu.ru/ )

• JQueryGradient < System < Foswiki
• JQueryPNotify < System < Foswiki
• JQueryUIDialog < System < Foswiki

Электронная библиотека Попечительского совета . ... John C. Hull - Options, Futures, and Other Derivatives -Solution Manual . ... Название: Options, Futures, and Other Derivatives -Solution Manual . Автор: John C. Hull . ... Solutions to the Questions and Problems are in Options, Futures, and Other Derivatives 7e: Solutions Manual which is published by Pearson and can be purchased by students. ... Электронная библиотека попечительского совета мехмата МГУ , 2004-2016 . ...

Еще в разделе: (Показать все результаты (>3870) - lib.mexmat.ru/ )

• Acklen L., O'Brien P. - Special Edition Using WordPerfect Office X3 ::
• Ballew J., Slack S.E. - Breakthrough Windows VistaT: Find Your Favorite
• Mun J. - Real Options Analysis. Tools and Techniques for Valuing Strategic

... 3.0.9 - 3.0.18 only, PHP 4 >= 4.0.0) cpdf_import_jpeg -- Opens a JPEG image . int cpdf_import_jpeg ( int pdf document, string file name, float x-coor, float y-coor, float angle, float width, float height, float x-scale, float y-scale [, int mode]) . The cpdf_import_jpeg() function opens an image stored in the file with the name file name . ... The image is placed on the current page at position ( x-coor , y-coor ). ... The optional parameter mode determines the unit length. ...

Еще в разделе: (Показать все результаты (>499) - oit.cmc.msu.ru/ )

• PHP Options&Information
• printer_set_option
• Using PHP from the command line

... Algorithm & . ... SDPsite is a tool for identification of protein active and other functional sites, based on spatial clustering of SDPs (specificity-determining positions, described here ) with CPs (conserved positions). The analysis begins with a multiple alignment of a protein family. ... Predict SDPs only . Predict CPs only . Predict SDPs and CPs . Map a pre-identified list of SDPs and/or CPs onto a structure ...

Еще в разделе: (Показать все результаты (>141) - bioinf.fbb.msu.ru/ )

• SDPsite - Algorithm Format requirements
• Algorithm
• SDPlight

. SDPpred: a tool for prediction of amino acid residues . that determine differences in functional specificity of homologous proteins .

Еще в разделе: (Показать все результаты (>403) - monkey.belozersky.msu.ru/ )

• About this project
• Example of supporting positions
• SDPpred

... Next: Scanners Up: Importing Images from Other Previous: Importing Images from Other Contents Index . ... Video or press button . The window where it is possible to select the driver will appear. Select the driver and press OK button, then the window, showing the movie from the videocamera will appear. Next time when the Command Video is selected or the button is pressed, the driver selection window won't appear any more, and the movie will be seen in a window. ...

Еще в разделе: (Показать все результаты (>69) - www.spm.genebee.msu.ru/ )

• Files Opening and Import
• Importing Images from Other Devices
• Changing Image Resolution