... 6 import sequence . ... 19 * self.alignment -- alignment object, which the block belongs to . ... 22 * self.positions -- list of positions of the alignment.body that . ... 34 def __init__ ( self , alignment , sequences = None , positions = None ): . ... sequences : . ... 75 If more than one pdb chain for some sequence provided, consider all of them . ... 129 alignment_sequence = self . ... 130 return ( alignment_sequence [ i ] for i in self . ... 132 def ca_atoms ( self , sequence , pdb_chain ): . ...

Еще в разделе: (Показать все результаты (>62798) - kodomo.fbb.msu.ru/ )

• allpy: 994b1a44bfc3 allpy/block.py
• allpy: 88444e25537c allpy/block.py
• allpy: 2b324332f6f7 allpy/block.py

... Alternative core new atoms (%) . ... An alignment of a set of structures is a set of positions , to each position some atoms from different structures correspond. ... Geometrical core of a set of structures is a subset of alignment positions those atoms are disposed similarly in all structures. ... For any two positions included into geometrical core, the distances between CA atoms of those positions in all structures may differ not more than the value of the parameter "Distance spreading". ...

Еще в разделе: (Показать все результаты (>6992) - mouse.belozersky.msu.ru/ )

• Blocks finder

. SDPpred: a tool for prediction of amino acid residues . that determine differences in functional specificity of homologous proteins .

Еще в разделе: (Показать все результаты (>1494) - monkey.belozersky.msu.ru/ )

• About this project
• Example of supporting positions
• Inquiry information || Distances

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>178) - www.genebee.msu.ru/ )

• AliGraf - GeneBee Graphical Alignment Help
• TreeTop - Phylogenetic Tree prediction
• Screening by similarity

... Algorithm & . Format requirements . ... SDPsite is a tool for identification of protein active and other functional sites, based on spatial clustering of SDPs (specificity-determining positions, described here ) with CPs (conserved positions). ... Mapping predictied positions onto structure and construction of the best cluster . ... The input data of the algorithm are a multiple protein alignment divided into specificity groups . ... is called statistical significance of the set of k* positions . ...

Еще в разделе: (Показать все результаты (>145) - bioinf.fbb.msu.ru/ )

• SDPlight
• SDPpred
• RNA Alignment

from Tkinter import * from State import * from Automata import * class Handlers(object): def __init__( self , cell_size=5, line_width=1 ,delay=10, offset_x=0, offset_y=0):# cell_size is size of cell, including line width, if there is it self.cell_size = cell_size self.line_width = line_width self .delay = delay self .offset_x = offset_x self .offset_y = offset_y self .after_id = 0 self .mouse_x = 0 self .mouse_y = 0 ...

Еще в разделе: (Показать все результаты (>6087) - kodomo.cmm.msu.ru/ )

• http://kodomo.cmm.msu.su/hg/petri_dish/raw-rev/2df48c61bd42
• http://kodomo.cmm.msu.su/trac/cca/browser/Interface.py?rev=10%3Ade4aaf1071ec&format=txt
• http://kodomo.cmm.msu.su/trac/cca/browser/Interface.py?rev=2b99826c4d292ee036791586048c4616654e9f05&format=txt

... Minimal size of Clud clusters (residues) . ... An alignment of a set of structures is a set of positions , to each position some atoms from different structures correspond. ... Hydrophobic cluster of a single protein structure is a separated pool of nonpolar atoms. Usually there is the biggest cluster in the protein called hydrophobic core. ... ConClus program is able to detect of conservative hydrophobic clusters for a family of related protein domains or just for a set of aligned proteins. ...

Еще в разделе: (Показать все результаты (>32) - mouse.genebee.msu.ru/ )

... 3.0.9 - 3.0.18 only, PHP 4 >= 4.0.0) cpdf_import_jpeg -- Opens a JPEG image . int cpdf_import_jpeg ( int pdf document, string file name, float x-coor, float y-coor, float angle, float width, float height, float x-scale, float y-scale [, int mode]) . The cpdf_import_jpeg() function opens an image stored in the file with the name file name . ... The image is placed on the current page at position ( x-coor , y-coor ). ... The optional parameter mode determines the unit length. ...

Еще в разделе: (Показать все результаты (>458) - oit.cmc.msu.ru/ )

• pg_loimport
• import_request_variables

NPG-explorer : a new tool for nucleotide pangenome construction and closely related prokaryotic genomes analysis Boris Nagaev2, Maxim Nikolaev2, Andrei Alexeevski 1 1,2,3* A.N.Belozersky Institute Of Physico-Chemical Biology and 2Faculty ... @gmail.com Moscow State University, Moscow 119991, Russia 3Scientific Research Institute of System Analysis (NIISI RAS), Moscow Genomes of closely related bacteria have highly similar sequences of orthologous ... Blocks are classified into four categories. ...

Еще в разделе: (Показать все результаты (>263) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/164.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/136.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/66.pdf

... To run the <LAYER> version of the example, select: flower.htm . ... However, if the page had several layers with absolute positions, and you wanted to place another layer in a relative position to one of the existing layers, you could use inline JavaScript to calculate the value for LEFT or TOP . ... In this example, there is really no need to use inline JavaScript to position the last flower layer, since you could just let the TOP value default to its natural value, as in the other flower layers. ...

Еще в разделе: (Показать все результаты (>1730) - crydee.sai.msu.ru/ )

• Index
• Long description illustrating absolute positioning with respect to the initial
• Long description for example illustrating positioning with respect to a

Evalign . Evalign is a computerised evaluation method for protein sequence alignment algorithm. It compares computer alignments with structural alignments of protein sequences and tells how correct your sequence alignment program is. It gives additional information on the characteristics of different alignment algorithms and shows types specific failings in alignment. ... None . ... SAL Home | Other Scientific Fields | Chemistry, Biology Related . ... SAL@KachinaTech.COM . ...

Еще в разделе: (Показать все результаты (>1678) - www.sai.msu.su/ )

• SAL- Other Scientific Fields - Chemistry, Biology Related - SC_rate
• SAL- Other Scientific Fields - Chemistry, Biology Related - ClustalW
• SAL- Other Scientific Fields - Chemistry, Biology Related - GRS

... Next: Files Saving and Export Up: Operations with files Previous: Operations with files Contents Index . To open the file press button or choose menu command File/ Open . ... Menu command File/ Open the same as Menu button , permits to open not only scanning probe microscopy files, but also to import data from text ASCII files and Bitmap files (extension BMP). The data in text files must be put in three columns (X, Y and Z) for surfaces importing, or in two or one columns for curves importing. ...

Еще в разделе: (Показать все результаты (>62) - www.spm.genebee.msu.ru/ )

• Importing Images from Other Devices

... It interpolates the grid at the positions in the table and writes out the table with the interpolated values added as a new column. A bicubic [Default] or bilinear [ -Q ] interpolation is used, requiring boundary conditions at the limits of the region (see -L flag option). xyfile This is an ASCII [or binary, see -b ] file where the first 2 columns hold the (x,y) positions where the user wants to sample the 2-D data set. ... Default is 2 input columns]. -bo Selects binary output. ...

Еще в разделе: (Показать все результаты (>206) - xray.sai.msu.ru/ )

• http://xray.sai.msu.ru/~ivan/gmt/man/blockmedian.html
• http://xray.sai.msu.ru/~ivan/gmt/man/blockmode.html
• http://xray.sai.msu.ru/~ivan/gmt/man/blockmean.html

Электронная библиотека Попечительского совета . ... Robbins J.N. - Web Design in a Nutshell . ... Название: Web Design in a Nutshell . Автор: Robbins J.N. Аннотация: . ... Our popular reference, Web Design in a Nutshell, is one of the first books to capture this new web landscape with an edition that's been completely rewritten and expanded to reflect the state of the art. ... Multimedia: Web audio, video, Flash, and PDF . ... Электронная библиотека попечительского совета мехмата МГУ , 2004-2016 . ...

Еще в разделе: (Показать все результаты (>5557) - lib.mexmat.ru/ )

• Pawson D. - XSL-FO :: Электронная библиотека попечительского совета мехмата МГУ
• Sachkov V.N., Tarakanov V.E. - Combinatorics of Nonnegative Matrices ::
• Weiss K.D. - Building an import/export business :: Электронная библиотека

Welcome , Registration , and other StartingPoints ; TWiki history & Wiki style; All the docs.. ... This page is a reference for all CSS classes used in PatternSkin . ... All templates that are not the view template have the body class name "patternNoViewPage". ... patternTopBar - top bar area .patternTopBarContents - table (for easy vertical alignment) for header art / logo; contains topic WebTopBar . ... Note: Please contribute updates to this topic on TWiki.org at TWiki:TWiki.PatternSkinCss . ...

Еще в разделе: (Показать все результаты (>33226) - dualopt1.cmm.msu.ru/ )

• %TOPICTITLE% (8 vs. 9) - TWiki
• %TOPICTITLE% (2 vs. 3) - TWiki
• %TOPICTITLE% (6 vs. 7) - TWiki

... Миграция из Outlook в Evolution . ... Evolution allows you to import old email and contacts so that you don't need to worry about losing your old information. ... Формат для хранения файлов календаря, который обычно используется Evolution, Microsoft Outlook, Sunbird и Korganizer. iCalendar или iCal (.ics): . ... Evolution/Mozilla/Outlook CSV/Tab (.csv, .tab): . ... Microsoft Outlook* and versions of Outlook Express after version 4 use proprietary formats that Evolution cannot read or import. ...

Еще в разделе: (Показать все результаты (>475) - uneex.lorien.cs.msu.su/ )

• HelpOnFormatting - UNИX
• HelpOnTables - UNИX
• Other Shortcuts

... Clouds and the Moon Move to Block the Sun . ... Explanation: High above a small church near Vienna, Austria , clouds and the Moon vied for position in front of the Sun. Such was the case on the ground late last month during a partial eclipse of the Sun visible throughout Europe and Asia . Nearing the farthest part of its orbit around the Earth , the Moon's angular size was too small to block the entire Sun, a situation that would have resulted in a total solar eclipse . ...

Еще в разделе: (Показать все результаты (>6370) - www.astronet.ru/ )

• Астронет > Clouds and the Moon Move to Block the Sun
• Waterton Lake Eclipse
• Journal "Peremennye Zvezdy"

... Кафедра общей экологии Биологического факультета МГУ им. М.В. Ломоносова и . Институт проблем экологии и эволюции им. А.Н. Северцова РАН . Активные темы Список участников Поиск по форуму Помощь . ... Экологический Форум - Фундаментальная Экология : Предложения и замечания по сайту . Тема: imports Cambridge Trade the as zero, ROSS . ... Переход на форум -- Выберите форум -- О сайте "Фундаментальная экология" - Предложения и замечания по сайту Научные семинары - Научные семинары . ...

Еще в разделе: (Показать все результаты (>2078) - www.sevin.ru/ )

• Экологический Форум - Фундаментальная Экология: Reported that imports often
• Экологический Форум - Фундаментальная Экология: to become in a position to
• Экологический Форум - Фундаментальная Экология: 2012, factors, imported private

Mustela . On a taxonomic position of the weasel (Carnivora, Mustela ) from the Cheju Island (South Korea) . ... The weasel from Cheju Island (formerly в?' Quelpart Island), which is situated in Korean Strait south of the coast of South Korea, was described as a separate species Lutreola quelpartis Thomas, 1908. ... Abramov A.V. 2000b. The taxonomic status of the Japanese weasel, Mustela itatsi (Carnivora, Mustelidae) // Zoologicheskii Zhurnal. ... A Pictorial Guide to the Mammals of Japan. ...

Еще в разделе: (Показать все результаты (>872) - zmmu.msu.ru/ )

• Taxonomic position of Eptesicus bobrinskoi - abstract

. A block of text is referred to in MicroEMACS as a 'region'. It is defined by the position of a special 'mark' at one end, and by the cursor (referred to as the 'point') at the other. This section explains how you can: . Move a block of text . Copy a block of text . Delete a block of text . Did You Know? .

Еще в разделе: (Показать все результаты (>113) - comet.sai.msu.ru/ )

• Moving a block of text
• Horizontal Tabs
• Rudnitskij Georgij M. Home Page