... help . ... 1.6 + 1.7 +All position indexes are counting from 1. 1.8 + 1.9 + import optparse 1.10 + import sys 1.11 + import os 1.12 +from allpy import protein 1.13 + 1.14 +def main(): 1.15 + alignment = protein. Alignment .from_fasta(open(options.in_file)) 1.16 + if not options.begin: 1.17 + options.begin = 1 1.18 + if not options. end : 1.19 + options. end = len( alignment .columns) 1.20 + columns = ...

Еще в разделе: (Показать все результаты (>35264) - kodomo.fbb.msu.ru/ )

• allpy: bcc658a78e61 test/usecase2.py
• allpy: b556c96c6719 utils/realign_block.py
• allpy: b556c96c6719 utils/flush_left.py

... It interpolates the grid at the positions in the table and writes out the table with the interpolated values added as a new column. A bicubic [Default] or bilinear [ -Q ] interpolation is used, requiring boundary conditions at the limits of the region (see -L flag option). xyfile This is an ASCII [or binary, see -b ] file where the first 2 columns hold the (x,y) positions where the user wants to sample the 2-D data set. ... Default is 2 input columns]. -bo Selects binary output. ...

Еще в разделе: (Показать все результаты (>277) - xray.sai.msu.ru/ )

• http://xray.sai.msu.ru/~ivan/gmt/man/fitcircle.html
• http://xray.sai.msu.ru/~ivan/gmt/man/gmtselect.html
• http://xray.sai.msu.ru/~ivan/gmt/man/blockmode.html

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>140) - www.genebee.msu.ru/ )

• AliGraf - GeneBee Graphical Alignment Help
• Genebee Predicted Annotation - Advanced
• AliComp - GeneBee Alignments Comparison - Advanced

Homepage: http://desandro.com/resources/jquery-masonry . ... Masonry is a layout plugin for jQuery. ... Whereas floating arranges elements horizontally then vertically, Masonry arranges elements vertically then horizontally according to a grid. ... Depending on the layout, you?ll most likely need to specify one option. ... Lorem ipsum dolor sit amet, consectetuer adipiscing elit. ... This topic: System > JQueryPlugin > JQueryMasonry . ... Ideas, requests, problems regarding Foswiki? ...

Еще в разделе: (Показать все результаты (>4559) - wiki.cmc.msu.ru/ )

• PatternSkinTheme < System < Foswiki

... To run the <LAYER> version of the example, select: flower.htm . ... However, if the page had several layers with absolute positions, and you wanted to place another layer in a relative position to one of the existing layers, you could use inline JavaScript to calculate the value for LEFT or TOP . ... In this example, there is really no need to use inline JavaScript to position the last flower layer, since you could just let the TOP value default to its natural value, as in the other flower layers. ...

Еще в разделе: (Показать все результаты (>1447) - crydee.sai.msu.ru/ )

... О UNИX . ... HelpOnTables . ... Table Markup . ... General table layout and HTML like options . ... Line breaks within cells . ... Bulleted lists and other complex content within cells To create a table, start & end a new line using the table marker; two 'pipe' characters " || ... top left cell || top right cell || || bottom left cell || bottom right cell || ... Just use CSS-formatted styles and it will be inlined in the generated HTML tag. <style="..."> will put that style info into cell (td) html ...

Еще в разделе: (Показать все результаты (>178) - uneex.mithril.cs.msu.su/ )

... О UNИX . ... HelpOnTables . ... Table Markup . ... General table layout and HTML like options . ... Line breaks within cells . ... Bulleted lists and other complex content within cells To create a table, start & end a new line using the table marker; two 'pipe' characters " || ... top left cell || top right cell || || bottom left cell || bottom right cell || ... Just use CSS-formatted styles and it will be inlined in the generated HTML tag. <style="..."> will put that style info into cell (td) html ...

Еще в разделе: (Показать все результаты (>485) - uneex.lorien.cs.msu.su/ )

• Informational Options
• License options
• Debugging Memory Allocation in APR - Apache HTTP Server

... E-mail . ... Этот e-mail защищен от спам-ботов. Для его просмотра в вашем браузере должна быть включена поддержка Java-script . ... Ведущий специалист . ... Главный специалист . ...

Еще в разделе: (Показать все результаты (>5) - www.ied.msu.ru/ )

... The first options file is /etc/ppp/options, which is always scanned when pppd starts up. ... It allows each user to specify her own set of default options. A sample /etc/ppp/options file might look like this: # Global options for pppd running on vlager.vbrew.com auth # require authentication usehostname # use local hostname for CHAP lock # use UUCP-style device locking domain vbrew.com # our domain name The first two of these options apply to authentication and will be explained below. ...

Еще в разделе: (Показать все результаты (>406) - itpm.msu.su/ )

• Kernel Options in 1.0 and Higher
• Link Control Options
• Kernel Options in 1.1.14 and Higher

... Usage ---+++ <nop>JavaScript API Configuring Masonry is fairly easy. ... For layouts with elements that span multiple widths: <verbatim class="js"> $('#wrapper').masonry({ columnWidth: 200 }); </verbatim> For layouts with elements that span the same width: <verbatim class="js"> $('#wrapper').masonry({ singleMode: true }); </verbatim> ---+++ Foswiki integration All containers classified as =jqMasonry= will be processed by this plugin. ... This topic: System > JQueryPlugin > JQueryMasonry . ...

Еще в разделе: (Показать все результаты (>1740) - wiki.cs.msu.ru/ )

... Algorithm & . ... SDPsite is a tool for identification of protein active and other functional sites, based on spatial clustering of SDPs (specificity-determining positions, described here ) with CPs (conserved positions). The analysis begins with a multiple alignment of a protein family. ... Predict SDPs only . Predict CPs only . Predict SDPs and CPs . Map a pre-identified list of SDPs and/or CPs onto a structure ...

Еще в разделе: (Показать все результаты (>141) - bioinf.fbb.msu.ru/ )

• SDPsite - Algorithm Format requirements
• Algorithm
• SDPlight

All Firefly versions can take optional command line arguments. ... firefly [optional command line options in any order] [optional list of working directories] . ... The list of most widely used command line options is given below: . ... Disables validity check of the command line arguments (e.g., check for valid names of files and directories, etc...) passed to Firefly. ... However, if this option is not given, one must provide the list of working directories when running Firefly in parallel mode. ...

Еще в разделе: (Показать все результаты (>65) - classic.chem.msu.su/ )

. Some commands accept multiple options. These can be grouped together after a single hyphen: command -abc argument . A small number of commands require each option to be given separately. Check the command synopsis for a command to see how a command requires its options to be given. An option that takes an argument, such as the name of a printer or a filename is given separately. Examples .

Еще в разделе: (Показать все результаты (>221) - comet.sai.msu.ru/ )

• Entering commands
• Command options
• Change an option value temporarily

... Options . ... Possible options, which can be used in the command line to start LanHEP are: . ... InDir directory Set the default directory where to search files, which included by read and use statements. -tex LanHEP generates LaTeX files instead of CompHEP model tables. -frc If -tex option is set, forces LanHEP to split 4-fermion and 4-color vertices just as it is made for CompHEP files. -texLines num Set number of lines in LaTeX tables to num . ...

Еще в разделе: (Показать все результаты (>748) - theory.sinp.msu.ru/ )

• [Comphep-common] Privacy Options of mail list

... Alternative core new atoms (%) . ... An alignment of a set of structures is a set of positions , to each position some atoms from different structures correspond. ... Geometrical core of a set of structures is a subset of alignment positions those atoms are disposed similarly in all structures. ... For any two positions included into geometrical core, the distances between CA atoms of those positions in all structures may differ not more than the value of the parameter "Distance spreading". ...

Еще в разделе: (Показать все результаты (>6977) - mouse.belozersky.msu.ru/ )

• NPG-explorer

... Options for
<tt> mpirun
</tt> . ... mpirun [mpirun_options...] <progname> [options...] . mpirun _ options : - arch architecture specify the architecture (must have matching machines. arch file in ${MPIR_HOME}/bin/machines) if using the execer -h This help -machine machine name use startup procedure for machine name -machinefile machine-file name Take the list of possible machines to run on from the file machine-file ... Special Options for Nexus device: . ... Центры . ...

Еще в разделе: (Показать все результаты (>584) - www.parallel.ru/ )

• MPI arguments for the application program | PARALLEL.RU -
• Command-line arguments for
  <tt> mpirun
  </tt> | PARALLEL.RU -
• MPI_Init | PARALLEL.RU - Информационно-аналитический центр по параллельным

Электронная библиотека Попечительского совета . ... John C. Hull - Options, Futures, and Other Derivatives -Solution Manual . ... Название: Options, Futures, and Other Derivatives -Solution Manual . Автор: John C. Hull . ... Solutions to the Questions and Problems are in Options, Futures, and Other Derivatives 7e: Solutions Manual which is published by Pearson and can be purchased by students. ... Электронная библиотека попечительского совета мехмата МГУ , 2004-2016 . ...

Еще в разделе: (Показать все результаты (>5113) - lib.mexmat.ru/ )

• Shreve S.E. - Stochastic Calculus for Finance 1 :: Электронная библиотека
• Henderson V., Hobson D.G. - Local time, Coupling and the Passport Option ::
• Mun J. - Real Options Analysis. Tools and Techniques for Valuing Strategic

... Type | ... Dict_init has one option: text value from dict_initoption and should return internal representation (structure) of dictionary. ... Arguments: pointer to HLPRSTEXT, pointer to query, pointer to option (as text pgsql's type) prs_lextype returns array of LexDescr (see wparser.h), describing types of lexem that can be returned by parser. =# \d pg_ts_cfgmap Table "public.pg_ts_cfgmap" Column | ... 0 Comments on Tsearch V2 in Brief This page is read-only View other revisions Administration . ...

Еще в разделе: (Показать все результаты (>1665) - www.sai.msu.su/ )

• Configuration Options
• xntpd - Network Time Protocol (NTP) daemon
• Authentication Options

IMPALA: Integrating Matrix Profiles And Local Alignments 1. ... Primary preprocessing Prepare the following files : i. a collection of PSI-BLAST-generated profiles with arbitrary names and suffix .chk; ii. a collection of profile master sequences , associated with the profiles , each in a separate file with arbitrary name and a 3 character suffix starting with c; the sequences can have deflines; they need not be sequences in nr or in any other sequence ...

Еще в разделе: (Показать все результаты (>3783) - kodomo.cmm.msu.ru/ )

• http://kodomo.cmm.msu.ru/~sandra/Term4/settings.txt
• http://kodomo.cmm.msu.ru/~plazmoliz/Term3/sup/man_ls.help
• http://kodomo.cmm.msu.ru/~turaro/term2/text/Prac1/ls.txt

Title Author Key words Features of middle class positioning in Russian informational and analytical press Vladykina M.I. middle class, an image, a position, object of influence, social subject This paper analyzes the characteristics of the image and the position of the Russian middle class, reflected in the press. The results of the content analysis of newspaper articles about the middle class. Identified some options contradictory image of the Russian middle class in the newspaper. Abstract

Еще в разделе: (Показать все результаты (>22) - www.socio.msu.ru/ )