... The approach for estimation of the homology search program sensitivity in nucleotide case was proposed in paper I.Anderson, A.Brass , "Searching DNA databases for similarities to DNA sequences: when is a match significant?" ... Seven sequences were chosen to have length varying from 100 to 1000 bp. ... Each of the 1000 artificially evolved sequences was used as a query for database search with Genebee search, blast-2.0.8 and fasta-3.3 as search engine. ... Sequence length . ... 100 . ... Blast 2.0 ....

Еще в разделе: (Показать все результаты (>203) - www.genebee.msu.ru/ )

• BLAST Basic Overview
• Databases
• GeneBee BLAST 2.2.22+ Services Help

... 14 def is_good_window ( window ): . ... 20 blocks = [] . 21 in_block = False . ... 24 in_block , was_in_block = is_good_window ( window ), in_block . 25 if in_block and not was_in_block : . ... Block . from_alignment ( alignment , columns = list ( window )) . ... 28 elif in_block : . ... 32 def blocks_markup ( alignment , blocks ): . ... 36 for column in block . ... in_block for column in alignment . ... 45 blocks = find_runs ( alignment ) . ... 52 blocks_markup ( alignment , blocks ), . ...

Еще в разделе: (Показать все результаты (>44771) - kodomo.fbb.msu.ru/ )

• allpy: a17d913cccef test/usecase1.py
• allpy: a1307c0bb030 sandbox/ttk.py
• allpy: a1307c0bb030 allpy/fileio.py

Just a little program for analysis of different alignments . ... Several words about COGs . ... COGs (Clusters of Orthologous Genomes) is a big database, which consists of thousands of alignments. Every alignment contains from 2 to almost infinite quantity sequences. ... It's very diffucult to look through big alignments, such as, for example, COG0495 (even though it is almost empty) - they contain too much lines. ... New sequences are discovered, new alignments are made and added into COGs. ...

Еще в разделе: (Показать все результаты (>1359) - monkey.belozersky.msu.ru/ )

• Molecular biology databases
• HTH3_species_distribution
• SVETKA, a program for multiple sequence alignments analysus

... Length = 10687 Score = 399 bits (1026), Expect = e-113 Identities = 202/337 (59%), Positives = 246/337 (72%), Gaps = 3/337 (0%) Frame = -3 Query : 3 YPFVRKALFQLDPERAHEFTFQQLRRITGTPFEALVRQKVPA---KPVNCMGLTFKNPLG 59 Y +RKALF LD E+AH+ T + L+ + +PF L++ P MGL FKNP+G Sbjct : 5999 YALIRKALFSLDAEQAHDLTIKTLKTLGRSPFNPLLKTLFACPTGSPKTIMGLHFKNPIG 5820 Query : 60 LAAGLDKDGECIDALGAMGFGSIEIGTVTPRPQPGNDKPRLFRLVDAEGLINRMGFNNLG 119 LAAG DK+GE I+ AMGFG IE+GTVTP Q GN KPR FRL +AEG+INR GFNN G ...

Еще в разделе: (Показать все результаты (>5344) - kodomo.cmm.msu.ru/ )

• http://kodomo.cmm.msu.ru/~plazmoliz/Term3/sup/all_blastn.txt
• http://kodomo.cmm.msu.ru/~plazmoliz/Term3/sup/cds_result.txt
• http://kodomo.cmm.msu.ru/~yaros/term3/BlockI/uchcodbel.txt

... MG1655 chromosome, complete genome Length=300 Score E Sequences producing significant alignments: (Bits) Value embl|AE009441|AE009441 Pyrobaculum aerophilum str. ... Length=2222430 Score = 98.4 bits (402), Expect = 5e-21 Identities = 150/234 (65%), Gaps = 1/234 (0%) Strand=Plus/Plus Query 68 CCCGCAGAAGAAGCACCGGCTAACTCCG-TGCCAGCAGCCGCGGTAATACGGAGGGTGCA 126 || ... Sbjct 97796 GTTCTCCCGCCGAAGTGCTTGAGATACTCGCAACCGTGAATCTCAAAAAGAGG 97848 > embl|AE006641|AE006641 Sulfolobus solfataricus P2, complete...

Еще в разделе: (Показать все результаты (>33) - mouse.genebee.msu.ru/ )

• http://mouse.genebee.msu.ru/~bennigsen/nhunt_files/ex2/blast_default.out
• http://mouse.genebee.msu.ru/~bennigsen/nhunt_files/ex2/megablast.out
• Nhunt: program for nucleic acid sequence similarity search

XAFS spectroscopy is widely used in physics, materials science, chemistry (especially in catalysis and coordination chemistry), biology, geochemistry and environmental science. ... This is an interface to the Glimpse -based search engine which enables you to find published papers in different fields of x-ray absorption spectroscopy -- XAFS, EXAFS, XANES, NEXAFS, SEXAFS, XEOL, and EXAFS-like phenomena in photoemission, electron-energy-loss spectra and so on. ... Database Search Form . ...

Еще в разделе: (Показать все результаты (>3) - scon155.phys.msu.ru/ )

The files containing information about Affymetrix microarrays were downloaded from the official Affymetrix site. ... Probe sequences were mapped to the genome using Blat. ... The hits found "probe alignment regions" were . ... We annotated each probe alignment region using the mRNA and EST alignments provided by UCSC, considering only . ... The textual part of the interface consists of probe information section, probe alignment section and transcription state . ... Each gene and each probe alignment . ...

Еще в разделе: (Показать все результаты (>6993) - mouse.belozersky.msu.ru/ )

• Geometrical core

The database of triplet periodicity change points Y.M. Suvorova, E.V. Korotkov Centre of Bioengineering Russian Academy of Sciences, 117312, prospect 60 -tya Oktyabrya 7/1, Moscow, Russia, suvorovay@gmail.com It is well-known that triplet periodicit y (TP) is the dist inguishing feature of protein coding sequences of the majorit y of the living organisms [1]. ... The current version o f the database includes 179 238 records of protein coding sequences with triplet periodicit y change points. ...

Еще в разделе: (Показать все результаты (>307) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/237.pdf
• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/215.pdf
• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/134.pdf

Recital . Character Mode Recital is a fully-functional Relational Database Management System and Fourth Generation Environment (RDBMS and 4GE) for Unix and OpenVMS systems. ... Recital will also open up access to your entire information systems environment by providing access to multiple database formats on both UNIX and VMS systems. ... Network access to Oracle, Ingres, Informix, DB2, and RDB data is handled with ease using the Recital Server Interface technology. ... Relational DBMS . ...

Еще в разделе: (Показать все результаты (>9327) - www.sai.msu.su/ )

• SAL- Database Systems - Utilities Other DBMS - Qbib
• SAL- Database Systems - Utilities Other DBMS - C/Base
• SAL- Database Systems - Object-Oriented DBMS - LINCKS

PHP Manual . ... Persistent connections are SQL links that do not close when the execution of your script ends. ... People who aren't thoroughly familiar with the way web servers work and distribute the load may mistake persistent connects for what they're not. ... For example, if you had 20 different child processes that ran a script that made a persistent connection to your SQL server, you'd have 20 different connections to the SQL server, one from each child. ... Connection handling . ...

Еще в разделе: (Показать все результаты (>577) - oit.cmc.msu.ru/ )

• yaz_database
• mhash_keygen_s2k
• Unix/Mac OS X installs

Next: Reverse Lookups Up: The Domain Name System Previous: Domain Name Servers . We have seen above that DNS does not only deal with IP-addresses of hosts, but also exchanges information on name servers. ... A single piece of information from the DNS database is called a resource record , or RR for short. ... Figure- shows a part of the domain database that is loaded into the name servers for the physics.groucho.edu zone. ... This comprises, for instance, the default time-to-live for all records. ...

Еще в разделе: (Показать все результаты (>399) - itpm.msu.su/ )

• Getting Acquainted with NIS
• The paths database
• nn Configuration

Электронная библиотека Попечительского совета . ... Bishop M.J. - Genetic Databases (Biological Techniques Series) . ... Название: Genetic Databases (Biological Techniques Series) . Автор: Bishop M.J. Аннотация: . ... The book describes the different types of databases, how to use a specific database to find a sequence that you need, and how to analyze the data to compare it with your own work. ... Электронная библиотека попечительского совета мехмата МГУ , 2004-2016 . ...

Еще в разделе: (Показать все результаты (>9606) - lib.mexmat.ru/ )

• Cumming A., Russell G. - SQL Hacks :: Электронная библиотека попечительского
• Michalski B. - Perl Database Programming :: Электронная библиотека
• Brown S.M. - Bioinformatics: A Biologist's Guide to Biocomputing and the

Databases (NSDC) of the Natural Planetary Satellites. ... NSDC: Database of astrometric observations of Natural Planetary Satellites . ... They are thoroughly looking for observations in different sources, creating their owndatabases which are then mostly inaccessible to other researchers. ... In the file "content" with explications, the reference is given to the data source as well as the bibliographic reference. ... Data sources. ... Why a specific bibliographic database for Natural satellites? ...

Еще в разделе: (Показать все результаты (>162) - lnfm1.sai.msu.ru/ )

You can search database for submitted information. ... Character * specifies arbitrary character sequence (eg. '*n' will result: John, Martin etc.) Character * is placed at end of line automatically ('Mar*' = 'Mar' will result: Martin, Martina etc.) Blank form will result ALL database records. ... Family name: . ... Topic: . ... Seismo-tectonics of Tsunami 3. Numerical and Analytical Models of Local Tsunami Behavior 4. ... Recent Local Tsunamis 8. ... Information . ... Database search . ...

Еще в разделе: (Показать все результаты (>32) - seac47-2.phys.msu.ru/ )

... Algorithm & . Format requirements . ... SDPsite is a tool for identification of protein active and other functional sites, based on spatial clustering of SDPs (specificity-determining positions, described here ) with CPs (conserved positions). ... Mapping predictied positions onto structure and construction of the best cluster . ... The input data of the algorithm are a multiple protein alignment divided into specificity groups . ... is called statistical significance of the set of k* positions . ...

Еще в разделе: (Показать все результаты (>144) - bioinf.fbb.msu.ru/ )

• SDPlight
• SDPpred
• SDPsite - Gallery of examples

... Apache HTTP Server Version 2.0 . ... htdbm is used to manipulate the DBM format files used to store usernames and password for basic authentication of HTTP users via mod_auth_dbm . ... mod_auth_dbm . ... Web password files such as those managed by htdbm should not be within the Web server's URI space -- that is, they should not be fetchable with a browser. ... The MD5 algorithm used by htdbm is specific to the Apache software; passwords encrypted using it will not be usable with other Web servers. ...

Еще в разделе: (Показать все результаты (>390) - uneex.lorien.cs.msu.su/ )

• Additional Options
• Rebuild Database Mode
• Initalize Database Mode

... Heterogeneous networks of multicomputers and the ch_nexus device . ... The startup files for the ch_nexus device are somewhat different, but easy to understand. ... If you have built MPI with ch_nexus device support on multiple platforms, you may not necessarily have the same startup_dir and startup_exe attribute values. ... The startup_count attribute indicates the number of nodes to be used on the SP-2 (in addition to any nodes you may be using on other workstations or multicomputers). ... Центры ...

Еще в разделе: (Показать все результаты (>610) - www.parallel.ru/ )

• Derived datatypes | PARALLEL.RU - Информационно-аналитический центр по
• Writing wrapper definitions | PARALLEL.RU - Информационно-аналитический центр

The mass terms for fermions in the electroweak theory are generated via their invariant Yukawa interaction with Higgs doublet. ... produces the mass terms for doublet components . which are accompanied by vertices of interactions of fermions with Goldstone fields: . ... Such terms form two mass matrices: one for upper and another for lower fermions. ... Generally the Lagrangian is written down in terms of fermion fields which directly correspond to particles. ...

Еще в разделе: (Показать все результаты (>1023) - theory.sinp.msu.ru/ )

• [Comphep-common] mass scan
• Numeration of Monte Carlo sessions

... About lab . ... Online Journal "Computer graphics and multimedia" (in russian) . ... We found that automatic models are significantly worse at predicting attention than even single-observer eye tracking. We propose a semiautomatic approach that requires eye tracking of only one observer and is based on time consistency of the observer?s attention. ... Gitman Y, Erofeev M, Vatolin D, Bolshakov A, Fedorov A. Semiautomatic Visual-Attention Modeling and Its Application to Video Compression . ...

Еще в разделе: (Показать все результаты (>236) - graphics.cs.msu.ru/ )

• Semiautomatic Visual-Attention Modeling | Лаборатория компьютерной графики и
• Image Database Retrieval by Fast Hermite Projection Method | Graphics and Media
• Image Database Retrieval by Fast Hermite Projection Method | Лаборатория

. ЭКОЛОГИЧЕСКАЯ ИНФОРМАЦИЯ . WEB- ориентированная библиографическая база данных .

Еще в разделе: (Показать все результаты (>7) - ecoinformatica.srcc.msu.ru/ )