... 9 container is iterable collection of items. 10 item is object getting markup data (new attribute). 11 . ... 32 def __init__ ( self , name , container , map_out = {}): . ... 40 def set_map_out ( self , map_out ): . ... 44 def set_map_in ( self , map_in ): . ... 54 def __getitem__ ( self , item ): . ... 65 def __contains__ ( self , item ): . ... 88 def from_string ( cls , string , name , container , map_out = {}): . ... 94 self = cls ( name , container , map_out ) . ... 103 def items ( self ): . ...

Еще в разделе: (Показать все результаты (>58804) - kodomo.fbb.msu.ru/ )

• allpy: c0eceeb6b223 allpy/markup.py
• allpy: 46d8caca3f47 allpy/markup.py
• allpy: 13f6a7c8b778 allpy/markup.py

... Instructions are in README.TXT file inside the tarball. ... tar -xvf nhunt_x86.tar Query and database files should contain sequences in FASTA format ( wikipedia description ). ... Default name of the output file is 'nhunt.out'. ... Any parameter consists of key and value and is called as '-key value', where 'key' is one character and 'value' is any number of characters. -i Query file . ... No default value. -d Database file . ... No default value. -o Output file . ... Default value: 'nhunt.out' . ...

Еще в разделе: (Показать все результаты (>33) - mouse.genebee.msu.ru/ )

... Content Model: Table Cells (TH or TD) . The TR element acts as a container for a row of table cells defined with the TH or TD elements. ... You also have the ability to disable word wrap for the row, and thereafter use the <BR> element to determine line breaks and hence cell widths. ... The recommended approach is to subclass rows using the CLASS attribute For example: <TABLE BORDER COLSPEC= .. ... ALIGN . ... This is used when you want to ensure that all cells in the row share the same baseline. ...

Еще в разделе: (Показать все результаты (>240) - comet.sai.msu.ru/ )

• HTML Math
• Divisions
• The IMG (Image) Element

. Name . Last Modified . Size . Type . Parent Directory / . - . Directory . ChangeLog . 2016-Jan-25 18:25:05 . 2.4K . application/octet-stream . ChangeLog-2015 . 2015-Nov-09 07:11:44 . 0.8K . application/octet-stream . Manifest . 2016-Jan-25 18:25:05 . 1.8K . application/octet-stream . data-default-instances-containers-0.0.1.ebuild . 2015-Aug-09 03:38:18 . 0.6K . text/plain . metadata.xml . 2016-Jan-25 02:06:09 . 0.3K . text/xml . lighttpd/1.4.35

Еще в разделе: (Показать все результаты (>23489) - mirror.msu.net/ )

IMPALA: Integrating Matrix Profiles And Local Alignments 1. ... Primary preprocessing Prepare the following files : i. a collection of PSI-BLAST-generated profiles with arbitrary names and suffix .chk; ii. a collection of profile master sequences , associated with the profiles , each in a separate file with arbitrary name and a 3 character suffix starting with c; the sequences can have deflines; they need not be sequences in nr or in any other sequence ...

Еще в разделе: (Показать все результаты (>7510) - kodomo.cmm.msu.ru/ )

• http://kodomo.cmm.msu.su/FBB/year_04/doc/BLAST_help/bl2seq.html
• http://kodomo.cmm.msu.su/FBB/year_04/doc/BLAST_help/fastacmd.html
• http://kodomo.cmm.msu.su/FBB/year_04/doc/BLAST_help/rpsblast.html

Each Apache configuration directive is described using a common format that looks like this: . Syntax: directive-name some args . ... Context: context-list . ... If the directive has a default value ( i.e. , if you omit it from your configuration entirely, the Apache Web server will behave as though you set it to a particular value), it is described here. ... A directive marked as being valid in this context may be used inside <Directory> containers in the server configuration files.htaccess . ...

Еще в разделе: (Показать все результаты (>825) - oit.cmc.msu.ru/ )

• xml_set_default_handler
• Pattern Modifiers
• Servers-Netscape and iPlanet

Лаборатория концентрирования, общая информация . ... общих вопросов аналитической химии (история, терминология, география, кадры, популяризация и др.; академик Ю.А. Золотов); . сорбционного концентрирования элементов, органических соединений и поиска новых сорбентов (группы д.х.н. Г.И. Цизина, д.х.н. С.Г. Дмитриенко, д.х.н. Е.И. Моросановой); . разработки экспрессных тест-методов химического анализа, главным образом вне лаборатории (группы д.х.н. Е.И. Моросановой, д.х.н С.Г. Дмитриенко); . ...

Еще в разделе: (Показать все результаты (>28) - analyt.chem.msu.ru/ )

... TWikiAttrsDotPm . Class of attribute sets, designed for parsing and storing attribute values from a TWiki tag e.g. %TAG{"joe" fred="bad" joe="mad"}% . ... The default parameter (unnamed quoted string) is named _DEFAULT in the hash. ... As well as the default TWiki syntax (parameter values double-quoted) this class also parses single-quoted values, unquoted spaceless values, spaces around the =, and commas as well as spaces separating values. ... remove ObjectMethod remove ($key) -> $value . ...

Еще в разделе: (Показать все результаты (>41051) - dualopt1.cmm.msu.ru/ )

• TWikiAttrsDotPm - TWiki - TWiki - (printable)
• WebSearchAdvanced - _default - TWiki
• WebSearch - _default - TWiki

Электронная библиотека Попечительского совета . ... Walrath K., Campione M., Huml A. - JFC Swing Tutorial, The: A Guide to Constructing GUIs . ... Название: JFC Swing Tutorial, The: A Guide to Constructing GUIs . Авторы: Walrath K., Campione M., Huml A. Аннотация: . ... The JFC Swing Tutorial: A Guide to Constructing GUIs provides a hard copy of Sun's popular online tutorial for Swing/JFC development. ... Электронная библиотека попечительского совета мехмата МГУ , 2004-2016 . ...

Еще в разделе: (Показать все результаты (>8953) - lib.mexmat.ru/ )

• Cardoza P. - Absolute Beginner's Guide to Microsoft Office OneNote 2003 ::
• Ray E. - Learning XML :: Электронная библиотека попечительского совета мехмата
• Cogswell J., Diggins C., Stephens R. - C++ Cookbook :: Электронная библиотека

This module is contained in the mod_setenvif.c file, and is compiled in by default. It provides for the ability to set environment variables based upon attributes of the request. The mod_setenvif module allows you to set environment variables according to whether different aspects of the request match regular expressions you specify. ... Module: mod_setenvif . Compatibility: Apache 1.2 and above (in Apache 1.2 this directive was found in the now-obsolete mod_browser module) . ...

Еще в разделе: (Показать все результаты (>643) - rtm-cs.sinp.msu.ru/ )

• Apache module mod_cgi
• Apache module mod_so
• Architecture

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>200) - www.genebee.msu.ru/ )

• AliGraf - GeneBee Graphical Alignment Help
• OUTPUT
• Fasta3 help

You are here: Foswiki > System Web > ReferenceManual > DeveloperDocumentationCategory > PerlDoc (19 Apr 2011, ProjectContributor ) E dit A ttach . See PublishedAPI for packages intended to be used by Plugin and Contrib authors, or browse all packages . ... internal package Foswiki::Configure::Valuer . ClassMethod new($defaults, $values) . ... A container for configuration data values. This class is used to refer to two hashes of configuration values. ... System . ... Admin Maintenance . ...

Еще в разделе: (Показать все результаты (>7237) - wiki.cmc.msu.ru/ )

• JQueryInnerFade < System < Foswiki

... ONLY include the controls you are actually using. ... only used if > -100 !Profile_xmax = 1.2 !-101 ! ... only used if > -100 Profile_other_ymax = -101 ! ... step number. negative means use default. ... negative means use same value as for window CONV_file_aspect_ratio = -1 ! negative means use same value as for window ! ... negative means use same value as for window Surf_Hist_file_aspect_ratio = -1 ! ... negative means use same value as for window Power_file_aspect_ratio = -1 ! ...

Еще в разделе: (Показать все результаты (>1611) - crydee.sai.msu.ru/ )

• http://crydee.sai.msu.ru/ftproot/pub/MESA-models/M6_Z002/inlist_project
• http://crydee.sai.msu.ru/ftproot/pub/MESA-models/M8_Z002/inlist_project
• http://crydee.sai.msu.ru/ftproot/pub/MESA-models/M7_Z002/inlist_project

... Foswiki::Search::InfoCache - Support package; cache of topic info. ... ObjectMethod finish() . ObjectMethod metacache . ... If _callback is set, that means the caller wants results as soon as they are ready. =_callback_ should be set to a reference to a function which takes _cbdata as the first parameter and remaining parameters the same as 'print'. ... Note: If format is set, template will be ignored. ... This topic: System > WebHome > ReferenceManual > DeveloperDocumentationCategory > PerlDoc . ...

Еще в разделе: (Показать все результаты (>2374) - wiki.cs.msu.ru/ )

• VarTWISTY < System < Foswiki
• WebRssBase < System < Foswiki
• VarBUTTON < System < Foswiki

Each Apache configuration directive is described using a common format that looks like this: . ... This indicates the format of the directive as it would appear in a configuration file. This syntax is extremely directive-specific, and is described in detail in the directive's definition. ... If the directive has a default value ( i.e. , if you omit it from your configuration entirely, the Apache Web server will behave as though you set it to a particular value), it is described here. ...

Еще в разделе: (Показать все результаты (>112) - neptun.sai.msu.ru/ )

• Apache module mod_log_common
• Manual Page: ab - Apache HTTP Server
• Apache module mod_dld

. SDPpred: a tool for prediction of amino acid residues . that determine differences in functional specificity of homologous proteins .

Еще в разделе: (Показать все результаты (>1836) - monkey.belozersky.msu.ru/ )

• ETS numeration assumed
• About COGs
• About this project

... Apache HTTP Server Version 2.0 . Apache > HTTP Server > Documentation > Version 2.0 > Programs . ab is a tool for benchmarking your Apache Hypertext Transfer Protocol (HTTP) server. ... This especially shows you how many requests per second your Apache installation is capable of serving. ... The default is to just perform a single request which usually leads to non-representative benchmarking results. -p POST-file . ... Use a proxy server for the requests. -y <tr>-attributes . ...

Еще в разделе: (Показать все результаты (>591) - uneex.lorien.cs.msu.su/ )

• Terms Used to Describe Directives - Apache HTTP Server
• site/sidemenu/default - UNИX
• VirtualHost Examples - Apache HTTP Server

... Apache HTTP Server Version 2.0 . Apache > HTTP Server > Documentation > Version 2.0 > Programs . ... ab is a tool for benchmarking your Apache Hypertext Transfer Protocol (HTTP) server. ... This especially shows you how many requests per second your Apache installation is capable of serving. ... The default is to just perform a single request which usually leads to non-representative benchmarking results. -p POST-file . ... Use a proxy server for the requests. -y <tr>-attributes . ...

Еще в разделе: (Показать все результаты (>491) - itpm.msu.su/ )

• send, wait and sleep
• Terms Used to Describe Directives - Apache HTTP Server
• Using Options Files

Apache2 Ubuntu Default Page . It works! This is the default welcome page used to test the correct operation of the Apache2 server after installation on Ubuntu systems. ... Ubuntu's Apache2 default configuration is different from the upstream default configuration, and split into several files optimized for interaction with Ubuntu tools. ... The configuration layout for an Apache2 web server installation on Ubuntu systems is as follows: /etc/apache2/ |-- apache2.conf | ... Document Roots . ...

20. http://xray.sai.msu.ru/~ivan/gmt/man/pstext.html