... 6 import sequence . ... 19 * self.alignment -- alignment object, which the block belongs to . ... 22 * self.positions -- list of positions of the alignment.body that . ... 25 Don't change self.sequences -- it may be a link to other block.sequences . ... 34 def __init__ ( self , alignment , sequences = None , positions = None ): . ... 75 If more than one pdb chain for some sequence provided, consider all of them . ... 129 alignment_sequence = self . ... 136 def sequences_chains ( self ): . ...

Еще в разделе: (Показать все результаты (>107662) - kodomo.fbb.msu.ru/ )

• allpy: e4f3a2022b08 lib/block.py
• allpy: 237deca17963
• allpy: 353379082202 allpy/block.py

... Algorithm & . Format requirements . ... SDPsite is a tool for identification of protein active and other functional sites, based on spatial clustering of SDPs (specificity-determining positions, described here ) with CPs (conserved positions). ... Mapping predictied positions onto structure and construction of the best cluster . ... The input data of the algorithm are a multiple protein alignment divided into specificity groups . ... is called statistical significance of the set of k* positions . ...

Еще в разделе: (Показать все результаты (>145) - bioinf.fbb.msu.ru/ )

• SDPlight
• Input Formats

... High-scoring Sequences . ... The E-value of a sequence is the expected number of sequences in a random database of the same size that would match the motifs as well as the sequence does and is equal to the combined p-value of the sequence times the number of sequences in the database. ... Sequence Name . ... Following the description line(s) is a line giving the length, combined p-value, and E-value of the sequence as defined in Section I. The next line reproduces the motif diagram from Section II. ...

Еще в разделе: (Показать все результаты (>7034) - kodomo.cmm.msu.ru/ )

... Parsimony method . ... It is based on the following principle: the ancestral sequences (posed in nodes of a phylogenetic tree) should be such that the minimal required number of character replacements on the branches of the tree is less than for any other choice of sequences. ... If the preliminary character of the node is * , but the output character of its immediate ancestor is some letter (say, X ), and its set of possible characters contains X , then the output character of the node is also X . ...

Еще в разделе: (Показать все результаты (>1495) - monkey.belozersky.msu.ru/ )

• Inquiry information || Distances
• SDP home page
• About this project

... Alternative core new atoms (%) . ... An alignment of a set of structures is a set of positions , to each position some atoms from different structures correspond. ... Geometrical core of a set of structures is a subset of alignment positions those atoms are disposed similarly in all structures. ... For any two positions included into geometrical core, the distances between CA atoms of those positions in all structures may differ not more than the value of the parameter "Distance spreading". ...

Еще в разделе: (Показать все результаты (>6988) - mouse.belozersky.msu.ru/ )

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>205) - www.genebee.msu.ru/ )

• RNA secondary structure prediction
• AliGraf - GeneBee Graphical Alignment Help
• Screening of pattern or alignment against PROTEIN databank

Detection of short size mutations and copy number alterations in ultra-deep targeted sequencing data Valentina Boeva, Emmanuel Barillot, Institut Curie, valentina.boeva@curie.fr Jean-Francois Laes OncoDNA, jf.laes@oncodna.com The emergence of the amplicon sequencing technique, which followed whole exome sequencing, promises a revolution in cancer diagnostics and treatment. ... Visualization of the typical configuration of read mappings (with Integrative Genomics Viewer). ...

Еще в разделе: (Показать все результаты (>285) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/136.pdf
• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/244.pdf
• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/4.pdf

... Minimal size of Clud clusters (residues) . ... An alignment of a set of structures is a set of positions , to each position some atoms from different structures correspond. ... Hydrophobic cluster of a single protein structure is a separated pool of nonpolar atoms. Usually there is the biggest cluster in the protein called hydrophobic core. ... ConClus program is able to detect of conservative hydrophobic clusters for a family of related protein domains or just for a set of aligned proteins. ...

Еще в разделе: (Показать все результаты (>32) - mouse.genebee.msu.ru/ )

... The first column gives the star identification number, followed by X, Y positions in mm. The zero point of these offsets is star number 1 which lies at 21:24:20.52 +36:30:25.6 (equator and equinox 2000). Next are relative proper motions (muX and muY) and their errors (ex and ey) in 10**4 arcsec/yr, followed by calculated V magnitudes. The final column gives the calculated membership probabilities in percent. ...

Еще в разделе: (Показать все результаты (>2382) - www.sai.msu.su/ )

• SAL- Other Scientific Fields - Chemistry, Biology Related - Evalign
• APOD: 2015 October 7 - La Palma Eclipse Sequence
• APOD: 2001 July 6 - Bakasa Eclipse Sequence

... 3.0.9 - 3.0.18 only, PHP 4 >= 4.0.0) cpdf_import_jpeg -- Opens a JPEG image . int cpdf_import_jpeg ( int pdf document, string file name, float x-coor, float y-coor, float angle, float width, float height, float x-scale, float y-scale [, int mode]) . The cpdf_import_jpeg() function opens an image stored in the file with the name file name . ... The image is placed on the current page at position ( x-coor , y-coor ). ... The optional parameter mode determines the unit length. ...

Еще в разделе: (Показать все результаты (>649) - oit.cmc.msu.ru/ )

• fseek
• import_request_variables
• odbc_columns

. Next: Initial velocity Up: Space and velocity distributions Previous: Space and velocity distributions . Following Paczynsky (1990), we assume initial space distribution of young neutron stars to be varying exponentially with distance from the Galactic center and from the Galactic plane, that is probability distribution for young neutron star positions can be written in the form . with kpc, and pc. Mike E. Prokhorov . Fri Jul 19 19:16:07 MSD 1996

Еще в разделе: (Показать все результаты (>315) - xray.sai.msu.ru/ )

This diagram illustrates the effects of absolutely positioning a box ("inner") with respect to a containing block established by a relatively positioned ancestor ("outer"). ... The "inner" box has been positioned relative to the top and left edges of the "outer" element's first inline box. ... The reference edges for positioning the "inner" box are indicated in the diagram by thick dashed lines. ... 1 Beginning of body contents.| ... 4 [(+200, -100)] 5 Inner 6 contents. ... Inner contents" is blue. ...

Еще в разделе: (Показать все результаты (>3816) - crydee.sai.msu.ru/ )

• Dynamic HTML in Communicator
• Long description illustrating absolute positioning with respect to the initial
• Long description for example illustrating absolute positioning

... The TAB element can be used when you want fine control over the horizontal positioning. The TAB element is used with the <tab id= name > attribute to define named tab stops. ... ALIGN . ... Following text up to next tab or line break is centered on the designated tab stop. ... Following text up to the next tab or line break is rendered flush right to the designated tab stop. ... The text up to the next tab or line break is then aligned such that the decimal point starts at the designated tab stop. ...

Еще в разделе: (Показать все результаты (>228) - comet.sai.msu.ru/ )

• Sorting on a specific part of a field
• HTML Math
• Defining the sort field

Электронная библиотека Попечительского совета . ... Robbins J.N. - Web Design in a Nutshell . ... Название: Web Design in a Nutshell . Автор: Robbins J.N. Аннотация: . ... Our popular reference, Web Design in a Nutshell, is one of the first books to capture this new web landscape with an edition that's been completely rewritten and expanded to reflect the state of the art. ... Multimedia: Web audio, video, Flash, and PDF . ... Электронная библиотека попечительского совета мехмата МГУ , 2004-2016 . ...

Еще в разделе: (Показать все результаты (>6824) - lib.mexmat.ru/ )

• Bao-Yen Tsui J. - Fundamentals of Global Positioning System Receivers: A
• ?im?a J., Kuc?ra R., Herman J. - Counting and Configurations: Problems in
• Moeller T.B. - Magnetic Resonance Imaging, Parameters and Positioning ::

previous next contents elements attributes . ... Changes to elements . New elements . ... The new elements in this version of HTML are Q , INS , DEL , ACRONYM , LEGEND , COLGROUP , BUTTON , and FIELDSET . ... These changes were additionally motivated by the desire to avoid future problems if this specification is extended to allow frame and rules attributes with other table elements. ... To solve these problems this specification introduces several new attributes and elements. ...

Еще в разделе: (Показать все результаты (>397) - itpm.msu.su/ )

• MySQL Reference Manual for version 3.23.10-alpha. - H Description of MySQL
• MySQL Reference Manual for version 3.23.10-alpha. - I What is Unireg?
• Outlook on the Following Chapters

XML-RPC HOWTO . Prev . Next . Fredrik Lundh has provided an excellent XML-RPC library for Python . ... You can either stick the *.py files in the same directory as your Python code, or you can install them in your system's Python directory. RedHat 6.2 users can type the following: $ mkdir xmlrpclib-0.9.8 $ cd xmlrpclib-0.9.8 $ unzip ../xmlrpc-0.9.8-990621.zip $ python >>> import xmlrpclib >>> import xmlrpcserver >>> Control-D $ su -c 'cp *.py *.pyc /usr/lib/python1.5/' . ...

Еще в разделе: (Показать все результаты (>619) - rtm-cs.sinp.msu.ru/ )

• A Java Client
• A Stand-Alone Java Server
• A Python Client

... Derived datatypes . Up: Point-to-Point Communication Next: Datatype constructors Previous: Null processes . ... Instead, MPI provides mechanisms to specify more general, mixed, and noncontiguous communication buffers. ... More general communication buffers are specified by replacing the basic datatypes that have been used so far with derived datatypes that are constructed from basic datatypes using the constructors described in this section. ... A sequence of basic datatypes . ... Центры . ...

Еще в разделе: (Показать все результаты (>371) - www.parallel.ru/ )

• Data Access Routines | PARALLEL.RU - Информационно-аналитический центр по
• Pack and unpack | PARALLEL.RU - Информационно-аналитический центр по
• Writing wrapper definitions | PARALLEL.RU - Информационно-аналитический центр

... Next: Files Saving and Export Up: Operations with files Previous: Operations with files Contents Index . To open the file press button or choose menu command File/ Open . ... Menu command File/ Open the same as Menu button , permits to open not only scanning probe microscopy files, but also to import data from text ASCII files and Bitmap files (extension BMP). The data in text files must be put in three columns (X, Y and Z) for surfaces importing, or in two or one columns for curves importing. ...

Еще в разделе: (Показать все результаты (>72) - www.spm.genebee.msu.ru/ )

• Importing Images from Other Devices
• Sample landing preferences

Astronomy Picture of the Day . ... Credit Copyright: Cenk E. Tezel and Tun Tezel ( TWAN ) Explanation: If you went outside at exactly the same time every day and took a picture that included the Sun, how would the Sun's position change? ... Yesterday, the Winter Solstice day in Earth's northern hemisphere, the Sun appeared at the bottom of the analemma. ... Pictured is such a total solar eclipse analemma or Tutulemma - a term coined by the photographers based on the Turkish word for eclipse. ...

Еще в разделе: (Показать все результаты (>7000) - www.astronet.ru/ )

• Journal "Peremennye Zvezdy"
• La Palma Eclipse Sequence
• Alaska Aurora Sequence

... Кафедра общей экологии Биологического факультета МГУ им. М.В. Ломоносова и . Институт проблем экологии и эволюции им. А.Н. Северцова РАН . Активные темы Список участников Поиск по форуму Помощь . ... Экологический Форум - Фундаментальная Экология : Предложения и замечания по сайту . Тема: 2012, factors, imported private market ob . ... Переход на форум -- Выберите форум -- О сайте "Фундаментальная экология" - Предложения и замечания по сайту Научные семинары - Научные семинары . ...

Еще в разделе: (Показать все результаты (>3310) - www.sevin.ru/ )

• Экологический Форум - Фундаментальная Экология: imports for term, the United
• Экологический Форум - Фундаментальная Экология: it import already Chinese and
• Экологический Форум - Фундаментальная Экология: imports Cambridge Trade the as