Aligned_sequences: 2 # 1: G3P1_ECOLI # 2: G3P3_ECOLI # Matrix: EBLOSUM62 # Gap_penalty: 10.0 # Extend_penalty: 0.5 # # Length: 150 # Identity: 66/150 (44.0%) # Similarity: 96/150 (64.0%) # Gaps: 3/150 ( 2.0%) # Score: 310.0 # # #======================================= G3P1_ECOLI 1 IKVGINGFGRIGRIVF-RAAQKRSDIEIVAINDLLDADYMAYMLKYDSTH 49 .| ... G3P3_ECOLI 51 GPFPWSVDFTEDSLIVDGKSIAVYAEKEAKNIPWKAKGAEIIVECTGFYT 100 G3P1_ECOLI 100 TDETARKHITAGAKKVVMTGPSKDNTPMFVKGANFDKYAGQD-IVSNASC 148 :.| ...

Еще в разделе: (Показать все результаты (>3622) - kodomo.cmm.msu.ru/ )

• http://kodomo.cmm.msu.ru/~Istar/Term4/alig.txt
• http://kodomo.fbb.msu.ru/~magepie/projects/term2/ahpf_ecoli.matcher
• Aligments

. Album : asv-album :: Travels to distant places and countries :: 1997/08 Kyoto, Nara (Japan) :: 23/08 Ryoanji Temple and around . Up . << Prev . A bug which produces loud high-pitched noise. The actual length is about 5-6 cm. Next >> . Created with the tool album generator a MarginalHack by David on Tue Jun 23 14:46:19 2015 .

Еще в разделе: (Показать все результаты (>1033) - crydee.sai.msu.ru/ )

• Mixing Length Theory
• Not so well documented Device Helpers in OS/2
• Descriptor index

... Chem., in press (1997) . ... Indicator tubes for the determination of heavy metals in solutions have been proposed. Preparation procedures for indicator powders based on noncovalent modifications of reversed-phased silica gel sorbents by analytical reagents have been developed. ... Procedures for the determination of Co(II), Fe(II, III), Cu(II), Cd, and the total content of heavy metals in water and solutions have been elaborated. ...

Еще в разделе: (Показать все результаты (>281) - chem.msu.ru/ )

... Class . ... FIELD | ... java.lang.Object | ucar.netcdf.Dimension . ... public class Dimension . ... A Dimension object is used to contain an array length which is named for use in multiple netcdf variables. This class supports construction, retrieval of the name and retrieval of the length value. ... protected int . ... Dimension (java.lang.String name, int length) . ... Constructor Detail public Dimension (java.lang.String name, int length) . ... length - int length of this Dimension . ...

Еще в разделе: (Показать все результаты (>35) - angel.cs.msu.su/ )

• : Class UnlimitedDimension
• Serialized Form
• : Class DecimateMap

Leaves opposite; stems with long internodes. ... Capsula with 2 big seeds.: ... Bracts of upper flowers nearly glabrous, it width is bigger, than length. ... Plants 9-14 cm height; mature leaves 5-9 cm length, glabrous, lower leaves are much shorter than upper leaves: P. schrenkii. ... Capsula obtuse, sometimes nearly round, with more than 12 small (near 0.8 mm length) seeds (very rare, plants from coast of Finnish bay - var. winteri - number of seeds is smaller, because part of ovules are aborting). ...

Еще в разделе: (Показать все результаты (>154) - herba.msu.ru/ )

• Key for the desctiption of plants from Centaurea stoebe/maculosa/diffusa group
• Материалы к полевому сезону

... Recommended values . Start word length . Start length of motiff for Multiple sequence alignment. ... Max N Mismatches . ... Min score . ... Gap parameter . This parameter defines gap scoring. the grater this value is the stronger gap will be panalysed . ... If inforation content of a column is less than given value the column should be not included into alignment. the grater this value is the stronger gap will be panalysed . ... Max loop . Max energy of a helix . ... cgcatagctc cacca . ...

Еще в разделе: (Показать все результаты (>11) - bioinf.fbb.msu.ru/ )

• RNA Alignment
• input
• RNA kinetics server

в строке vstr, заменяет vpat на vrep ====== function replace(vpat,vrep,vstr) { var myindex=vstr.indexOf(vpat); var replen=vrep.length; if (myindex != -1) { var vstr1=vstr.substring(0,myindex)+vrep; var vstr_con=vstr.substring(myindex+replen); vstr1+=replace(vpat,vrep,vstr_con); return vstr1; } else { return vstr; } } function isEmpty( vdata ) { if ( vdata.length 0) { for ( var i=0; i vdata.length ; i++) { if ( ...

Еще в разделе: (Показать все результаты (>29) - genphys.phys.msu.su/ )

Next: SYSTEM CALL: msgctl() Up: 6.4.2 Message Queues Previous: SYSTEM CALL: msgget() . ... To deliver a message to a queue, you use the msgsnd system call: . ... The first argument to msgsnd is our queue identifier, returned by a previous call to msgget . ... The msgsz argument contains the size of the message in bytes, excluding the length of the message type (4 byte long). ... The fourth argument ( mtype ) specifies the type of message to retrieve from the queue. ...

Еще в разделе: (Показать все результаты (>91) - itpm.msu.su/ )

• MySQL Reference Manual for version 3.23.10-alpha. - E Known errors and design
• mod_deflate - Apache HTTP Server
• MySQL Reference Manual for version 3.23.10-alpha. - SQL command, type and

... Attempt to optimize some properties of fluorescent chimeras of human small heat shock protein HspB1 by modifying linker length and nature. ... Chimerical proteins consisting of enhanced yellow fluorescent protein (EYFP) connected by linkers of different length and nature to the N-terminal end of small heat shock protein HspB1 were obtained and characterized. ... Long flexible linkers should be used to obtain fluorescent chimeras with chaperone-like properties similar to those of the wild-type HspB1....

Еще в разделе: (Показать все результаты (>18) - biochem.bio.msu.ru/ )

... MRAM). ... 14.1, IBM, . 2006 3.5 200 , , 2004 - 100 . 14.1. ... 14.5. (bit length) (bit width) . ... 100 . ... LIMDOW (Light Intensity Modulated Direct OverWrite - ). LIMDOW- , . LIMDOW 100% . ... MRAM - magnetic/magnetoresistive random access memory) , , , , . MRAM, RAM(Random Access Memory). ... MRAM RAM (SRAM) RAM (DRAM) - RAM, . ... bit lines) (word lines) ( . ... MRAM IBM, , Siemens, Motorola, Philips, Hewlett Packard, Hitachi. ... Motorola 1 Mb MRAM, [2]. ...

Еще в разделе: (Показать все результаты (>57) - danp.sinp.msu.ru/ )

• http://danp.sinp.msu.ru/MagNanoS/L9.pdf

Links to DC resistivity and IP software in WWW ] . ... Download Free-version of IPI2win (1600K) [maximal profile length is 10] . Manual for ipi2win from Alva Kurniawan . Spanish version . ... IPI2win is a program for 1D automatic and manual interpretation of VES curves. ... VES curves could be received with different arrays: Schlumberger , Wenner , dipole-dipole , pole - pole . ... Simultaneously You could see how new parameter fits with field curve and another models of profile. ...

Еще в разделе: (Показать все результаты (>32) - geophys.geol.msu.ru/ )

... My field of specialization is Stability Theory, Nonlinear Dynamics, Asymptotic Methods, Mechanics of Solids, System Identification, Optimal Control, Economic Growth. ... A.O. Belyakov and A.P. Seyranian (2012). ... A.O. Belyakov and A.P. Seyranian, . ... A.P. Seyranian and A.O. Belyakov, Swing dynamics. ... A.O. Belyakov, A.P. Seyranian, and A. Luongo, Regular and chaotic dynamics of the swing. 6th EUROMECH Nonlinear Dynamics Conference (ENOC 2008) , Saint Petersburg, Russia, June, 30 - July, 4 2008...

Еще в разделе: (Показать все результаты (>9) - belyakov.imec.msu.ru/ )

Выберите категорию обращения: Общие вопросы Отчеты Рейтинги Диссертационные советы Конкурсы Ввод данных Структура организаций Пользователи Проблемы с регистрацией\входом в систему . ... Minina N.Ya , Bogdanov E.V. , Shirokov S.S. в журнале Journal of Physics: Conference Series , издательство Institute of Physics (United Kingdom) , том 215, с. 012175-1-012175-4 DOI . ... Bogdanov E.V. , Brandt N.B. , Minina N.Ya , Shirokov S.S. , Yunovich A.E. в журнале MOSCOW UNIVERSITY PHYSICS BULLETIN , том 65, ? ...

Еще в разделе: (Показать все результаты (>793) - istina.msu.ru/ )

• Popov A.B. - сотрудник | ИСТИНА - Интеллектуальная Система Тематического
• Okorokov A.I. - сотрудник | ИСТИНА - Интеллектуальная Система Тематического
• Bantysh Olga B. - сотрудник | ИСТИНА - Интеллектуальная Система Тематического

. choose a word from a dictionary . use personal information such as your name, make of car etc. tell anyone your password . write your password down anywhere . use the password you were given when you first got your account on the system . choose an obscure password preferably between 6 and 8 characters in length, of mixed case and containing at least one non-alphanumeric character such as ! or @ . change your password at regular intervals .

Еще в разделе: (Показать все результаты (>43) - comet.sai.msu.ru/ )

• Examples of using the pr command

Welcome , Registration , and other StartingPoints ; TWiki history & Wiki style; All the docs.. ... VarQUERYSTRING 3 - 2005-03-27 - Main.TWikiContributor . ... name="TWikiVariables" . ... String of all the URL parameters that were on the URL used to get to the current page. ... Note: URLs built this way are typically restricted in length, typically to 2048 characters. If you need more space than this, you will need to use an HTML form and %QUERYPARAMS% . ... Related: QUERYPARAMS , URLPARAM . ...

Еще в разделе: (Показать все результаты (>25566) - dualopt1.cmm.msu.ru/ )

• VarQUERYSTRING - TWiki - TWiki - (printable)
• %TOPICTITLE% (1 vs. 2) - TWiki
• %TOPICTITLE% (7 vs. 8) - TWiki

... Acousto-Optic Cells with Non-Uniform Length of Light and Sound Interaction . ... The paper examines operation of acousto-optic cells designed with cross section of acoustic columns different from the traditional rectangular form. ... It is evident that application of the   transducers possessing the complicated shape of the electrodes results in unequal lengths of light and sound interaction over cross section of an incident optical beam. ... Section : 9 ...

Еще в разделе: (Показать все результаты (>43) - acs366.phys.msu.su/ )

• AUTHOR : Knyazev G
• AUTHOR : Voloshinov V
• Abstract (Invited)

О лаборатории . ... Лаборатория теоретической биофизики . ... The script generates nanotubes of arbitrary structure. ... To use it, save script to some file, then load into PyMol with the command: run /path/to/script.py . ... Here comes the script : # Nanotubes generating script for PyMol by piton at erg .biophys.msu.ru import cmd from math import cos,sin,pi,ceil,floor, acos from chempy import models, cpv class cell: def __init__(self ... 2011 ERG Research Group . ...

Еще в разделе: (Показать все результаты (>56) - erg.biophys.msu.ru/ )

Afterpulses measurements for the ANTARES PMT Vladimir Kulikovskiy INFN Genova / SINP MSU 07/06/2011 Afterpulses measerements, V.Kulikovskiy, INFN Genova / SINP MSU 01/10 Spurious pulses l Afterpulses type 1. l l 1a due to escaped e1b due to escaped l l l 2) afterpulse type 2. ... Afterpulses measerements, V.Kulikovskiy, INFN Genova / SINP MSU 04/10 Pre-pulses & late pulses. ... Prepulse and delayed pulse ­ are the "main" pulses (one pulse only). main pulse afterpulse 1.0%. ...

Еще в разделе: (Показать все результаты (>6) - antares.sinp.msu.ru/ )

• http://antares.sinp.msu.ru/docs/Kulikovsky%20-%20NEMO&ANTARES.pdf

... 1997; Yvon, Wadsworth, 1997; Vorobjev et al., 1997; Borisy, Rodionov, 1999). ... Cell Research. ... Ahmad F.J., Yu W., McNally F.J., Baas P.W. An essential role for katanin in severing microtubules in the neuron // J. Cell Biol. ... In this study, the average length of microtubules in cultured Vero cells was estimated using a combined approach. ... Thus, most microtubules in the lamella of Vero cells are free and their ordered arrangement is not associated with their attachment to the centrosome. ...

Еще в разделе: (Показать все результаты (>30) - cellmotility.genebee.msu.ru/ )

• http://cellmotility.genebee.msu.ru/html/articles/Vorobjev03.pdf
• http://cellmotility.genebee.msu.ru/html/articles/alieva2000.pdf

... This hypothesis is tested using fluid inclusions studies on mineral samples from three Allihies Mines, and quartz veins and a calcite related to a carbonatite intrusion at Black Ball Head. ... classify and compare the different fluid inclusion types hosted in quartz and calcite; . ... Type 1 and Type 2 inclusions occur at both the Allihies and Black Ball Head localities and are hosted by both quartz and calcite, whereas Type 3 inclusions are restricted to the host mineral quartz. ...

Еще в разделе: (Показать все результаты (>242) - geo.web.ru/ )

• Informal geological society (RSG SG )