AC201621_1 [21 - 896] Candidatus Regiella insecticola clone CUGI_APP_BA-012A24, WORKING DRAFT SEQUENCE, 2 ordered pieces. ... MLILQATLSVVLTMVGALFLSGQRIQTNFVKPLCQNPSQLMMIQLMMMLPVGLKICLNHE IDNRFLCIPFAFQVTALLSAGARRIT >AC201621_7 [5313 - 5023] (REVERSE SENSE) Candidatus Regiella insecticola clone CUGI_APP_BA-012A24, WORKING DRAFT SEQUENCE, 2 ordered pieces. ...

Еще в разделе: (Показать все результаты (>4939) - kodomo.cmm.msu.ru/ )

• http://kodomo.cmm.msu.ru/~ksenechka91/names.txt
• TracTicketsCustomFields тАУ Tanchiki
• TracUpgrade тАУ Tanchiki

Go to the first , previous , next, last section, table of contents . ... Alias names, case sensitivity . ... BLOB columns, indexing . ... Case sensitivity, of table names , Case sensitivity, of table names . ... Choosing version . ... Compatibility, between MySQL versions , Compatibility, between MySQL versions . ... Manual information . ... MySQL version , MySQL version . ... References . ... Table names, case sensitivity , Table names, case sensitivity . ... Wildcards, in mysql.tables_priv table . ...

Еще в разделе: (Показать все результаты (>649) - itpm.msu.su/ )

• MySQL Reference Manual for version 3.23.10-alpha. - E Known errors and design
• MySQL Reference Manual for version 3.23.10-alpha. - H Description of MySQL
• Apache 2.0 Hook Functions - Apache HTTP Server

... Winner of joint DAAD (German Academic Exchange Service) and Moscow State University Scholarships Program ?Vladimir Vernadskii? for joint research in Germany. 2011-present. ... 16.11-12.12.2009, Collaborative Research Center 701 of Bielefeld University, Bielefeld, Germany. ... Another ham sandwich in the plane? (joint work with Alexey Balitskiy and Roman Karasev from Moscow Insitute of Physics and Technology), November 9, 2013, Kolloquium Kombinatorik, TU Ilmenau, Ilmenau, Germany. ...

Еще в разделе: (Показать все результаты (>130) - higeom.math.msu.su/ )

... RenderListPlugin 7 - 2004-03-21 - PeterThoeny . ... Plugin Version: . ... attr="h" comment="Empty 16x16 spacer" date="1070519327" name="empty.gif" path="C:\Data\MyTWiki\Plugins\RenderListPlugin\pub\TWiki\RenderListPlugin\empty.gif" size="100" user="PeterThoeny" version="1.1" . ... attr="h" comment="Dot T-graph 16x16" date="1070519374" name="dot_udr.gif" path="C:\Data\MyTWiki\Plugins\RenderListPlugin\pub\TWiki\RenderListPlugin\dot_udr.gif" size="109" user="PeterThoeny" version="1.1" . ...

Еще в разделе: (Показать все результаты (>39141) - dualopt1.cmm.msu.ru/ )

• TWikiMetaData - TWiki - TWiki

applause- demo .zip 349607 Applause (scanner/bitmap app ) demo arcadia.zip 557523 Arcadia workplace companion demo aurum4op.zip 485671 order processing system ( demo ) ba2pr40d.zip 1287682 BackAgain/2 Pro 3.1 demo bc1eng.zip 3910925 BlueCad 1.0 demo (english) bc1ger.zip 3967555 BlueCad 1.0 demo ( german ) biaf100d.zip 219264 Demo version of backup software (no tape support) bm3demo.zip 1980006 Backmaster/2 ...

Еще в разделе: (Показать все результаты (>4355) - crydee.sai.msu.ru/ )

• Fortran 90 for the Fortran 77 Programmer
• Installing the System
• Springer LINK: Astronomy and Astrophysics - Contents

. Department of general physics . and magneto-ordered matter . Faculty of Physics . Moscow State University . General Information . Education . Scientific research . Main Info . At physics faculty . Research laboratories and groups . Staff . At natural faculties . Publications . Contacts . International collaboration . Russian Version . Server of Physics department . Main server of MSU

Еще в разделе: (Показать все результаты (>26) - ferro.phys.msu.ru/ )

• Кафедра общей физики и физики конденсированного состояния

. Russian version . About the Center . Publications . Workshops . Databases (in Russian) . Send Your remarks by email

Еще в разделе: (Показать все результаты (>67) - hist.msu.ru/ )

• Web-ресурсы по экономической истории

Shipunov A.B. Systema Angiospermarum [Electronic resource]. 1991 onwards. ... Current version: . Classification , PDF (version information inside) . ... Version 5.1 , PDF, used in: Shipunov A., Reveal J.L. Validation of subordinal names for "Systema Angiospermarum" // Phytotaxa. ... Version 4.977 , PDF, used in: Reveal J.L. Summary of recent systems of angiosperm classification // Kew Bulletin. ... The system is traditional: it means that paraphyletic taxa are widely (but not elsewhere) accepted. ...

Еще в разделе: (Показать все результаты (>169) - herba.msu.ru/ )

• Systema Naturae
• Alga-base

... The basic core of the COMAGMAT-5.2 (2013) program includes the algorithm that has been used in previous versions of the COMAGMAT model (ver. 3.0-3.5) designed to simulate mafic magma crystallization processes . ... Ariskin A.A., Bychkov K.A., Danyushevsky L.V., McNeill A.W., Barmina G.S., Nikolaev G.S. (2012) COMAGMAT-5: a new magma crystallization model designed to simulate mafic to ultramafic sulfide-saturated systems. ... Contact ariskin@geokhi.ru . ... Ariskin A.A., Barmina G.S., Frenkel M.Ya., ...

Еще в разделе: (Показать все результаты (>252) - geo.web.ru/ )

. [ Войти ] . Главная -> Фильмы -> Reverse of the Curse of the .. Пользователи . Демо . Деньги . Фильмы . Форум . Reverse of the Curse of the Bambino . США 2004 . отметить . Документальный . Спорт .

Еще в разделе: (Показать все результаты (>127) - kinfo.ru/ )

• Pok?mon Ruby Version - Фильмы - Kinfo.ru
• Pok?mon Gold/Silver Version - Фильмы - Kinfo.ru
• Pok?mon: FireRed Version - Фильмы - Kinfo.ru

Welcome to K -corrections calculator, simple service allowing one to determine K -corrections of a galaxy, given its redshift and one or more colours. ... Please note that galaxy redshift should stay in the range between 0.0 and 0.5. ... K -correction in choose filter.. AB mag --- SDSS u SDSS g SDSS r SDSS i SDSS z UKIDSS Y UKIDSS J UKIDSS H UKIDSS K --- Vega mag --- Johnson U Johnson B Johnson V Cousins Rc Cousins Ic 2MASS J 2MASS H 2MASS Ks . Redshift . Colour choose colour.. ...

Еще в разделе: (Показать все результаты (>7) - kcor.sai.msu.ru/ )

install ]] . ... Installation of a user directory . ... Below, we use the following notations: XXXX - CompHEP version number; comphep-XXXX - directory where CompHEP files will live; comphep-XXXX.tgz - distributive tar-file with sources; comphep-XXXX-linux.tgz - distributive tar-file with binaries; . ... The directory with name comphep-XXXX will be created with all files of CompHEP distributive. ... In order to create a user working directory execute: make setup WDIR=path_to_user_work_directory . ...

Еще в разделе: (Показать все результаты (>23) - comphep.sinp.msu.ru/ )

• download:main [CompHEP]
• overview [CompHEP]
• news [CompHEP]

... Manual pages are often copyrighted material. You may not have permission to view those held on this machine. If these links return an error message, view the page locally instead. ranlib - convert archives to random libraries . rcp - remote file copy . rcs - change RCS file attributes . ... rlogin - remote login . ... rup - show host status of local machines (RPC version) . ruptime - show host status of local machines . rusers - who's logged in on local machines (RPC version) . ...

Еще в разделе: (Показать все результаты (>141) - comet.sai.msu.ru/ )

• What is the latest versions of each file?
• Check out an early version of a file
• Collection of Net References - Frame version

The Fastdiag dynamic library (fastdiag.dll of Windows PC GAMESS/Firefly distributions, fastdiag.ex of Linux distributions) contains fast optimized modern algorithms of symmetric matrix diagonalization and inversion and is intended to improve the performance of initial guess generation, DIIS extrapolation, as well as some other computationally-intensive steps. ... However, DC-based code requires large amount of extra memory. ... It is usually as fast as kdiag=-1 but requires as much memory as kdiag=0. ...

Еще в разделе: (Показать все результаты (>100) - classic.chem.msu.su/ )

• Two years later: Firefly version 8.0.0 beta benchmarks on Intel Core i7 2600K
• PC GAMESS version 7.1 to version 7.1.5 update information
• Firefly DOCUMENTATION - command line arguments

... Dear site visitors, We are happy to present you english version of the site of the Department of Biochemistry! . ... Graduates of 2011 year . Graduates of 2012 year . Graduates of 2013 year . ... Graduates of 2010 year . Graduates of 2009 year . Graduates of 2008 year . Graduates of 2007 year . Graduates of 2006 year . Graduates of 2005 year . Graduates of 2004 year . Graduates of 2003 year . Graduates of 2002 year . Graduates of 2001 year . ...

Еще в разделе: (Показать все результаты (>73) - biochem.bio.msu.ru/ )

• Biochemistry Department of Moscow State University | About us
• Reversibility of nucleoside diphosphate kinase solubilization from the surface

Support ] [ Links to DC resistivity and IP software in WWW ] . ... TRF_2D for Windows - Automated 2D Inversion Program for VES Travers Data. ... The scientists of the laboratory are developing algorithms and computer programs for decision of forward and inverse problems of resistivity and induced polarization methods, which are widely known in Russia and are applied in many countries abroad. ... IE2DL - the set of the programs for resistivity and IP data modeling in 2D inhomogeneous media . ...

Еще в разделе: (Показать все результаты (>47) - geophys.geol.msu.ru/ )

• Theory of resistivity sounding
• IPI2win - 1D interpretation of VES profile.
• Links of engineering geophysics and software

Schools of Philology, Psychology, and of the Arts, Moscow State University held 1-3 October, 2010 an international conference entitled . FREE VERSE AND FREE DANCE: EMBODIED SENSE IN MOTION . ... In addition to paper sessions and thematic round-table discussions, the conference included master classes in free dance & musical movement training, sessions of vers libres, sound poetry, dance and contact improvisation, and site-specific performances. All master classes were open for participants. ...

Еще в разделе: (Показать все результаты (>3) - discours.philol.msu.ru/ )

The biofouling problems in reverse osmosis and ultrafiltration elements are considered. ... Based on obtained data the prognosis for point-of-use reverse osmosis element applied on tap water was done. ... Keywords: reverse osmosis, ultrafiltration, biofouling, biofilm, prediction of product flow decrease, removal of foulants. ... Flemming H.-C. Reverse Osmosis Membrane Biofouling. ... Flemming H. C., Schaule G., Investigation on biofouling of reverse osmosis and ultrafiltration membranes. ...

Еще в разделе: (Показать все результаты (>351) - chem.msu.ru/ )

• Benzene alkylation with alkanes over modified MFI catalysts
• Moscow University Chemistry Bulletin Vol. 43, No. 1, P. 20 (2002)
• Moscow University Chemistry Bulletin Vol. 47, No. 2, P. 134 (2006)

... Описание программы (постановка задачи, ввод информации для счета, вывод информации, примеры расчетов, текст программы) - pdf 574К . Выполняемый файл - rar 260К . ... Описание программы (постановка задачи, ввод информации для счета, вывод информации, примеры расчетов, текст программы) - pdf 602К . Выполняемый файл - rar 125К . ... Описание программы (постановка задачи, ввод информации для счета, вывод информации, примеры расчетов, текст программы) - pdf 498К . ... Описание программы - pdf 160 . ...

Еще в разделе: (Показать все результаты (>24) - cryst.geol.msu.ru/ )

• http://cryst.geol.msu.ru/