Query [NEEDLEP-JobName:temp_job1] found 1 entries . Apply Options to: . selected results only . ... 5 10 20 30 50 100 200 500 1000 2000 3000 10000 . ... Aligned_sequences: 2 # 1: KPYK2_ECOLI # 2: KPYM_HUMAN # Matrix: EBLOSUM62 # Gap_penalty: 10.0 # Extend_penalty: 0.5 # # Length: 369 # Identity: 139/369 (37.7%) # Similarity: 192/369 (52.0%) # Gaps: 37/369 (10.0%) # Score: 539.0 # # #======================================= KPYK2_ECOLI 1 RLRRTKIVTTLGPATDRDNNLEKVIAAGANVVRMNFSHGSPEDHKMRADK 50 .. ...

Еще в разделе: (Показать все результаты (>3649) - kodomo.cmm.msu.ru/ )

... 3.0.3 - 3.0.18 only, PHP 4 >= 4.0.0) ifx_htmltbl_result -- Formats all rows of a query into a HTML table . ... Formats all rows of the result_id query into a html table. ... name, $connid, IFX_SCROLL); if (! $rid) { ... error ... } $rowcount = ifx_affected_rows ($rid); if ($rowcount > 1000) { printf ("Too many rows in result set (%d)\n<br>", $rowcount); die ("Please restrict your query<br>\n"); } if (! ifx_do($rid) { ... error ... } ifx_htmltbl_result ($rid, "border=\"2\""); ifx_free_result($rid); ....

Еще в разделе: (Показать все результаты (>926) - oit.cmc.msu.ru/ )

• MySQL Functions
• odbc_setoption
• FrontBase Functions

... Query: E. coli K12 tRNA (valV, selC, asnV, leuT, argZ from EMBL entry U00096 ) . ... BLASTN (both) | ... Nhunt . ... BLASTN (optimal): 3.5 s . BLASTN (default): 0.8 s . ... Nhunt: 7 s The program Nhunt surpass all other tested programs in sensitivity. ... Nhunt BLASTN (optimal): 2.9 s . ... Nhunt: 3.7 s BLASTN with default parameters actually cannot find any significant homologues. ... Nhunt-3: 1.7 s BLASTN with default parameters actually cann't find any significant homologues. ...

Еще в разделе: (Показать все результаты (>20) - mouse.genebee.msu.ru/ )

You are here: Foswiki > System Web > WebSearch > SearchHelp (revision 1) E dit A ttach . By default a search looks into topic titles, topic texts and form fields in the current web . ... Multiple words are combined: intranet web service returns all pages that have the three words anywhere in the page . ... Use Google-like queries as in soap "web service" -shampoo ; searches word parts: using the example, topics with "soapsuds" will be found as well, but topics with "shampoos" will be excluded . ...

Еще в разделе: (Показать все результаты (>6537) - wiki.cmc.msu.ru/ )

• (backlinks in all Webs) FormattedSearch < System < Foswiki
• (backlinks in System Web) FormattedSearch < System < Foswiki
• JQueryMasonry < System < Foswiki

Backlinks to FormattedSearch in System Web ( Search all webs ) . ... NEW - 25 Mar 2011 - 14:59 by ProjectContributor . ... NEW - 03 Aug 2010 - 16:42 by ProjectContributor . ... Developer Documentation Application Developer Topics Topics for normal users that want to develop Foswiki applications. ... NEW - 10 Apr 2011 - 22:07 by ProjectContributor . ... NEW - 20 Sep 2010 - 08:56 by ProjectContributor . ... NEW - 22 Feb 2011 - 12:42 by ProjectContributor . ... NEW - 01 May 2014 - 17:23 by UnknownUser . ...

Еще в разделе: (Показать все результаты (>3128) - wiki.cs.msu.ru/ )

• (backlinks in all Webs) FormattedSearch < System < Foswiki
• JQueryMasonry < System < Foswiki
• (backlinks in System Web) VarTWISTYTOGGLE < System < Foswiki

. sort sends its results directly to your screen. To save them to a file use the -o option. For example: sort -o mail addresses . This saves the results of sorting the file addresses in the file mail .

Еще в разделе: (Показать все результаты (>223) - comet.sai.msu.ru/ )

• Examples of using the sort command
• Merging sorted files
• Finding a file

xntpd implements a general purpose address-and-mask based restriction list. ... The restriction facility was implemented in conformance with the access policies for the original NSFnet backbone time servers. ... Ignore all packets from hosts which match this entry. ... Default restriction list entries, with the flags ignore, ntpport , for each of the local host's interface addresses are inserted into the table at startup to prevent the server from attempting to synchronize to its own time. ...

Еще в разделе: (Показать все результаты (>2068) - www.sai.msu.su/ )

• Ranking
• Zen: Gin
• Reference Clock Options

Maximum RPM: Taking the Red Hat Package Manager to the Limit . ... RPM's query mode is used to display information about packages: . Format: rpm --query <options> . ... Query all packages. -f <file> + ? Query package owning <file> . ... Query packages with group <group> . ... If no information selection option is present on the command line, RPM will simply display the applicable package label(s): . ... Display package information. -l ? Display package file list. -s ? ... Verify Mode ...

Еще в разделе: (Показать все результаты (>528) - uneex.lorien.cs.msu.su/ )

• ChapterѓЉ13.ѓЉ Toolbox
• Informational Options
• Two handy options

... NatSearch . ... It uses one input field to either jump to a topic or perform a query. ... if your input starts with an uppercase letter, NatSearch tries to find the named topic and jumps to it; you may enter the target topic using the web.topic notation . if your input starts with an uppercase letter but does not exist as a topic, a topic search tries to find it; if there is exactly one search hit, NatSearch jumps to it directly . ... a regular expression that must match a topic in the hit set . ...

Еще в разделе: (Показать все результаты (>38333) - dualopt1.cmm.msu.ru/ )

• NatSearch - TWiki - TWiki - (printable)

grd2cpt - Read a grdfile and make a color palette file grd2cpt grdfile [ -C cptmaster ] [ -I ] [ -L minlimit / maxlimit ] [ -S zstart / zstop / zinc ] [ -V ] [ -Z ] grd2cpt reads a grdfile and writes a color palette (cpt) file to standard output. The cpt file is based on an existing master cptfile of your choice, and the mapping from data value to colors is through the data's cumulative distribution function (CDF), so that the colors are histogram equalized. ... S Set steps in cpt file. ...

Еще в разделе: (Показать все результаты (>606) - xray.sai.msu.ru/ )

• http://xray.sai.msu.ru/~ivan/gmt/man/makecpt.html
• http://xray.sai.msu.ru/~ivan/gmt/man/grdhisteq.html
• ADS Abstract Service Results

... Basic channels . ... To add new channel, You have to select one of the spectral operations from the Operations list, modify or set the operations parameters and select one (for unary operations) or two (for binary operations) parent spectral channels. ... Subset of parameters in parent channel parameters vector . ... Using the left mouse button, mark the speech frames in the recorded speech (white columns in the lower spectral window, corresponding to the parent channel of this speech detector). ...

Еще в разделе: (Показать все результаты (>110) - www.intsys.msu.ru/ )

... This program was created for correlating chosen regions in the series of fts images. ... Chosen regions' . ... In this section the program counts the integral for each region of the grid for each image. ... As a matter of fact, the integral is total brightness of the region and it is counted by 'int_tabulated' IDL function. ... In addition, the program will show the count of the regions which correlate with the corresponding region (the brighter region means the bigger count) and its contour. ...

Еще в разделе: (Показать все результаты (>322) - lnfm1.sai.msu.ru/ )

• Manpage of FITSHDR
• FITShdr: INSTALL
• Manpage of FITSHDR_EDIT

... GeneBee . ... AliBee - Multiple Alignment . ... Result Alignment Format: . GeneBee Fasta (Pearson) Fasta (DNA) Clustal (ALN) Phylip PIR Text . ... Comments on output . Tree and Picture Options . Extra tree format . None Phylip Phylip (multiline) Nexus Nexus (TREES block only) Hennig86 . Picture formats . None Slanted Slanted 2 Rectangular Rectangular 2 Phylogram Unrooted Unrooted 2 . ... You can paste or edit your sequences right here (in FASTA format) . ...

Еще в разделе: (Показать все результаты (>158) - www.genebee.msu.ru/ )

• NCBI BLAST Advanced Options
• BLAST Frequently Asked Questions (FAQ)
• OUTPUT

... Results . Aligned_sequences: 2 # 1: SYYM_HUMAN # 2: SYY_ECOLI # Matrix: EBLOSUM62 # Gap_penalty: 10.0 # Extend_penalty: 0.5 # # Length: 324 # Identity: 131/324 (40.4%) # Similarity: 185/324 (57.1%) # Gaps: 45/324 (13.9%) # Score: 619.5 # # #======================================= SYYM_HUMAN 1 ------QTIYCGFDPTADSLHVGHLLALLGLFHLQRAGHNVIALVGGATA 44 .. ... SYY_ECOLI 133 RLNREDQGISFTEFSYNLLQGYDFACLNKQYGVVLQIGGSDQWGNITSGI 182 SYYM_HUMAN 183 EFINKLTGEDVFGITVPLITSTTGAKLGKSAGNAVWLNRDKTSPFELYQF 232 :.. ...

Еще в разделе: (Показать все результаты (>13044) - kodomo.fbb.msu.ru/ )

• allpy: b556c96c6719 utils/extract_pfam.py
• allpy: 3a216769da26
• allpy: bcc658a78e61 sandbox/ttk.py

... E-mail . ... Этот e-mail защищен от спам-ботов. Для его просмотра в вашем браузере должна быть включена поддержка Java-script . ... Ведущий специалист . ... Главный специалист . ...

Еще в разделе: (Показать все результаты (>4) - www.ied.msu.ru/ )

... Экологический Форум - Фундаментальная Экология : Предложения и замечания по сайту . Тема: as a result of a further difficulty . ... Even though pondering the myriad of model choices available for sunglasses, Oakley sun shades will take quite a few of those even, a single move additional. ... The sole things you are not any more time about to come across within the Oakley sun shades line <a href=http://www.sunglassesoutletstores.org/?ref=72>cheap oakley on sale</a> of merchandise are the sttoard. ...

Еще в разделе: (Показать все результаты (>4476) - www.sevin.ru/ )

• Экологический Форум - Фундаментальная Экология: know paragraph lower results
• Экологический Форум - Фундаментальная Экология: the spending results can should
• Экологический Форум - Фундаментальная Экология: as a result of a further...

All Firefly versions can take optional command line arguments. ... firefly [optional command line options in any order] [optional list of working directories] . ... The list of most widely used command line options is given below: . ... Disables validity check of the command line arguments (e.g., check for valid names of files and directories, etc...) passed to Firefly. ... However, if this option is not given, one must provide the list of working directories when running Firefly in parallel mode. ...

Еще в разделе: (Показать все результаты (>107) - classic.chem.msu.su/ )

• Firefly/PC GAMESS standard MCQDPT2 benchmark results on modern hardware
• Firefly/PC GAMESS standard MP4 benchmark results on modern hardware
• The PC GAMESS SMP scaling results for model MP4-SDQ job

Network Working Group Request for Comments: 495 NIC #15371 Categories: TELNET, Protocols References: RFCs 318, 435; NIC 7104 A. McKenzie BBN-NET 1 May 1973 TELNET Protocol Specification Following much discussion of TELNET via the RFC series, an open meeting was held at UCLA on 5 March to formulate a new specification for the TELNET Protocol. ... Between these two dates, sites may gradually implement and test the "interpreter" for the new commands. ...

Еще в разделе: (Показать все результаты (>19420) - mirror.msu.net/ )

• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/rfc495.txt
• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/pdfrfc/rfc7314.txt.pdf
• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/rfc7314.txt

Next: Message Routing and Delivery Up: Getting smail Up and Previous: Mail Delivery Modes . There are quite a number of options you may set in the config file, which, although useful, are not essential to running smail, and which we will not discuss here. ... error copy postmaster . ... If the hop count for a message (i.e. the number of hosts already traversed) equals or exceeds this number, attempts at remote delivery will result in an error message being returned to the sender. ...

Еще в разделе: (Показать все результаты (>441) - itpm.msu.su/ )

• ab - Apache HTTP server benchmarking tool - Apache HTTP Server
• htpasswd - Manage user files for basic authentication - Apache HTTP Server
• MySQL Reference Manual for version 3.23.10-alpha. - F List of things we want to

... H4 H4 align = center Выберите интересующий вас пункт: /H4 center form action= result _ form .php select name = mode size=1 !-- option name = mode value =envelope Обработка результатов расчета оболочек / option //-- option name = mode value =zams Обработка результатов расчета моделей звезд / option H4> <H4 align=center>Возврат в <A href="stev_web.html">Главное меню</A>.< H4> </form> </body> </html> ...

Еще в разделе: (Показать все результаты (>52) - observ.pereplet.ru/ )

• Author Query Results
• Справка RESULT
• Transitsearch - HD 80606 b results