AC192956_1 [2191 - 2502] Candidatus Regiella insecticola clone CUGI_APP_BA-03-N07, complete sequence. ... MPTALKLPLCGQDVRPMSVDYYVIRANARSQQHGGFKGEGYSKLSSPVQPYGKNHKQSLH LANRHLSLPDTNHFQHQQTGVVLTHVAPIIQHWHPAARSMIHNTIRQPFQISKSAYWQYL YQLTSPLLHVFFLIVLAIDQTARLNNGQRENYEQHPKLTAAVQ >AC192956_4 [6714 - 5449] (REVERSE SENSE) Candidatus Regiella insecticola clone CUGI_APP_BA-03-N07, complete sequence. ...

Еще в разделе: (Показать все результаты (>3873) - kodomo.cmm.msu.ru/ )

• Blast Result
• WikiDeletePage (diff) тАУ Tanchiki
• BIOH_ECOLI по данным UniProt

This document describes how to perform update from the PC GAMESS version 7.1 build # 4471 to the PC GAMESS version 7.1.5 build # 4630 . Verify that your PC GAMESS installation is version 7.1 build # 4471. ... Note that this patch works only with the official PC GAMESS v. 7.1 build # 4471 binaries. ... After successful completion of the patch process, the PC GAMESS version 7.1.5 build # 4630 binary executable file will be written to the file pcgamess.715.exe (Windows)/ pcgamess.715 (Linux). ...

Еще в разделе: (Показать все результаты (>92) - classic.chem.msu.su/ )

• PC GAMESS/Firefly DOCUMENTATION - FAST MATRIX DIAGONALIZATION AND INVERSION
• Two years later: Firefly version 8.0.0 beta benchmarks on Intel Core i7 2600K

... Bacteria rearranged . ... 2002) . ... Some improvements in Bacteria according Cavalier-Smith (2002b), Woese et al. (2000) and Wolf et al. 2001) . ... Several genera added (Patterson, 1999) . ... Cryothecomonas and Metopion moved (Kuhn et al., ... Major improvements and rearrangements to Protista (Stechmann, Cavalier-Smith, 2002; Cavalier-Smith, 2002; Cavalier-Smith, 2000) . ... Chaetognatha moved to Ecdysozoa, Nematomorpha to Nemathelminthes, Spiralia rearranged (Mallatt, Winchell, 2002) . ...

Еще в разделе: (Показать все результаты (>152) - herba.msu.ru/ )

• Systema Angiospermarum

... A regular expression (regex) is a powerful way of specifying a complex search. MySQL uses regular Henry Spencer's inplementation of regular expressions. ... MySQL uses the extended version. This is a simplistic reference that skips the details. To get more exact information, see Henry Spencer's regex(7) manual page that is included in the source distribution. ... A regular expression describes a set of strings. The simplest regexp is one that has no special characters in it. ...

Еще в разделе: (Показать все результаты (>651) - itpm.msu.su/ )

• Reverse Lookups
• Dokumentation zum Apache HTTP Server Version 2.0 - Apache HTTP Server
• sendsys, version, and senduuname

This file gives information for users who want to upgrade from an older version to XFree86-3.3.6 -------------------------------------------------------------- Please read the whole text completely, before taking any action. ... Remove them and completely install the recent version 3.3.6. ... If you want to upgrade from 3.2 to the version 3.3.6: It is not recommended to copy new files over old ones. 3.3.6 contains the new X11R6.3 code base which is in some aspects INCOMPATIBLE to 3.2. ...

Еще в разделе: (Показать все результаты (>4480) - crydee.sai.msu.ru/ )

• http://crydee.sai.msu.ru/ftproot/pub/rec/games/idgames/levels/doom2/a-c/chaosbt2.txt
• http://crydee.sai.msu.ru/ftproot/pub/rec/games/idgames/levels/doom/g-i/hellu101.txt
• http://crydee.sai.msu.ru/ftproot/pub/rec/games/idgames/levels/doom/a-c/boom-tc2.txt

Welcome , Registration , and other StartingPoints ; TWiki history & Wiki style; All the docs.. ... TWikiStoreDotPm 3 - 2006-06-25 - Main.TWikiContributor . ... Reads the given version of a topic and it's meta-data. If the version . Revision 3 . r3 - 2006-06-25 - 16:26:33 - TWikiContributor . ... Copyright by the contributing authors. ... Ideas, requests, problems regarding TWiki? ... Note: Please contribute updates to this topic on TWiki.org at TWiki:TWiki.TWikiStoreDotPm . ...

Еще в разделе: (Показать все результаты (>38464) - dualopt1.cmm.msu.ru/ )

• TWikiTip017 - TWiki - TWiki
• %TOPICTITLE% (43 vs. 44) - TWiki
• TWikiTip017 - TWiki - TWiki - (printable)

. Russian version . About the Center . Publications . Workshops . Databases (in Russian) . Send Your remarks by email

Еще в разделе: (Показать все результаты (>68) - hist.msu.ru/ )

• Web-ресурсы по экономической истории

. [ Войти ] . Главная -> Фильмы -> Reverse of the Curse of the .. Пользователи . Демо . Деньги . Фильмы . Форум . Reverse of the Curse of the Bambino . США 2004 . отметить . Документальный . Спорт .

Еще в разделе: (Показать все результаты (>83) - kinfo.ru/ )

• Pok?mon: Emerald Version - Фильмы - Kinfo.ru
• Pok?mon: LeafGreen Version - Фильмы - Kinfo.ru
• Pok?mon: FireRed Version - Фильмы - Kinfo.ru

Welcome to K -corrections calculator, simple service allowing one to determine K -corrections of a galaxy, given its redshift and one or more colours. ... Please note that galaxy redshift should stay in the range between 0.0 and 0.5. ... K -correction in choose filter.. AB mag --- SDSS u SDSS g SDSS r SDSS i SDSS z UKIDSS Y UKIDSS J UKIDSS H UKIDSS K --- Vega mag --- Johnson U Johnson B Johnson V Cousins Rc Cousins Ic 2MASS J 2MASS H 2MASS Ks . Redshift . Colour choose colour.. ...

Еще в разделе: (Показать все результаты (>7) - kcor.sai.msu.ru/ )

... Reversibility of nucleoside diphosphate kinase solubilization from the surface of the outer mitochondrial membrane. ... It was found that in medium with low ionic strength nucleoside diphosphate kinase (NDPK) solubilization from the outer membrane of liver mitochondria could be partially reversed by the addition of 3.3 mM MgCl2. ... After solubilization of NDPK in the absence of leupeptin, cathepsins damage sites of its binding on the membranes. ...

Еще в разделе: (Показать все результаты (>80) - biochem.bio.msu.ru/ )

• Biochemistry Department of Moscow State University | English version of the...
• Synergetic inhibition of the brain mitochondrial NADH:ubiquinone oxidoreductase
• Biochemistry Department of Moscow State University | About us

download:main ]] . CompHEP . ... Latest versions . ... This Licence entitles the Licensee (one person) and the Licensee's research group to obtain a copy of the source or executable code of CompHEP and/or interfaces of CompHEP to other Monte-Carlo generators and to use the acquired program for academic research or other non-profit purposes within a research ... Source codes of CompHEP, v4.5.2 (release candidate 12) . ... Source codes of CompHEP, v4.4.93 (preliminary test version of 4.5.0) . ...

Еще в разделе: (Показать все результаты (>23) - comphep.sinp.msu.ru/ )

• install [CompHEP]
• news [CompHEP]
• download:rn-061106 [CompHEP]

. To see which versions of each file are current use the command: sccs what filename(s) .

Еще в разделе: (Показать все результаты (>145) - comet.sai.msu.ru/ )

• Check out an early version of a file
• Listing directories on the remote host
• Collection of Net References - Frame version

... The basic core of the COMAGMAT-5.2 (2013) program includes the algorithm that has been used in previous versions of the COMAGMAT model (ver. 3.0-3.5) designed to simulate mafic magma crystallization processes . ... Ariskin A.A., Bychkov K.A., Danyushevsky L.V., McNeill A.W., Barmina G.S., Nikolaev G.S. (2012) COMAGMAT-5: a new magma crystallization model designed to simulate mafic to ultramafic sulfide-saturated systems. ... Contact ariskin@geokhi.ru . ... Ariskin A.A., Barmina G.S., Frenkel M.Ya., ...

Еще в разделе: (Показать все результаты (>228) - geo.web.ru/ )

• Untitled Document
• Pavel Yu. Pletchov

List of Publications Elena A. Kudryavtseva March 2007 1. Gerver, M. L. and Kudryavtseva, E. A. (1995): A theorem on precedence relations generated by completely positive kernels. ... Russian Math. ... Gonё calves, D.L., Kudryavtseva, E., and Zieschang, H. (2001): Intersection index of curves on surfaces and applications to quadratic equations in free groups. ... Gonё calves, D.L., Kudryavtseva, E., and Zieschang, H. (2002): Ro ots of mappings on nonorientable surfaces and equations in free groups. ...

Еще в разделе: (Показать все результаты (>28) - dfgm.math.msu.su/ )

• http://dfgm.math.msu.su/files/koudr/publ3eng.pdf

Support ] [ Links to DC resistivity and IP software in WWW ] . ... TRF_2D for Windows - Automated 2D Inversion Program for VES Travers Data. ... The scientists of the laboratory are developing algorithms and computer programs for decision of forward and inverse problems of resistivity and induced polarization methods, which are widely known in Russia and are applied in many countries abroad. ... IE2DL - the set of the programs for resistivity and IP data modeling in 2D inhomogeneous media . ...

Еще в разделе: (Показать все результаты (>47) - geophys.geol.msu.ru/ )

• Theory of resistivity sounding
• IPI2win - 1D interpretation of VES profile.
• Links of engineering geophysics and software

Schools of Philology, Psychology, and of the Arts, Moscow State University held 1-3 October, 2010 an international conference entitled . FREE VERSE AND FREE DANCE: EMBODIED SENSE IN MOTION . ... In addition to paper sessions and thematic round-table discussions, the conference included master classes in free dance & musical movement training, sessions of vers libres, sound poetry, dance and contact improvisation, and site-specific performances. All master classes were open for participants. ...

Еще в разделе: (Показать все результаты (>3) - discours.philol.msu.ru/ )

... Winner of joint DAAD (German Academic Exchange Service) and Moscow State University Scholarships Program ?Vladimir Vernadskii? for joint research in Germany. 2011-present. ... 16.11-12.12.2009, Collaborative Research Center 701 of Bielefeld University, Bielefeld, Germany. ... Another ham sandwich in the plane? (joint work with Alexey Balitskiy and Roman Karasev from Moscow Insitute of Physics and Technology), November 9, 2013, Kolloquium Kombinatorik, TU Ilmenau, Ilmenau, Germany. ...

Еще в разделе: (Показать все результаты (>137) - higeom.math.msu.su/ )

The biofouling problems in reverse osmosis and ultrafiltration elements are considered. ... Based on obtained data the prognosis for point-of-use reverse osmosis element applied on tap water was done. ... Keywords: reverse osmosis, ultrafiltration, biofouling, biofilm, prediction of product flow decrease, removal of foulants. ... Flemming H.-C. Reverse Osmosis Membrane Biofouling. ... Flemming H. C., Schaule G., Investigation on biofouling of reverse osmosis and ultrafiltration membranes. ...

Еще в разделе: (Показать все результаты (>286) - chem.msu.ru/ )

• Moscow University Chemistry Bulletin Vol. 51, No. 2, P. 102 (2010)
• Moscow University Chemistry Bulletin Vol. 44, No. 1, P. 13 (2003)
• Moscow University Chemistry Bulletin Vol. 43, No. 1, P. 20 (2002)

... Method Detail protected final void init ( ConcreteIndexMap.ZZMap iMap, ConcreteIndexMap.ZZMap lengthsMap) . ... iMap - ZZMap defining the forward transform. protected final void link ( ConcreteIndexMap prev, ConcreteIndexMap.ZZMap iMap, ConcreteIndexMap.ZZMap lengthsMap) . ... prev - ConcreteIndexMap this is composed with. iMap - ZZMap defining the forward transform. lengthsMap - ZZMap defining the reverse transform. protected final void link ( ConcreteIndexMap prev, ConcreteIndexMap.ZZMap iMap) . ...

Еще в разделе: (Показать все результаты (>32) - angel.cs.msu.su/ )

• : Class NetcdfFile
• Appendix B File Format Specification
• Appendix D NetCDF 2 C Transition Guide