... We are grateful to Scott Atchley (Myricom) for providing us by benchmark data on this cluster. ... Press to visit PC GAMESS v. 7.0.7 benchmarks and scalability on large Opteron Pathscale Infinipath Infiniband Linux cluster page . Press to visit PC GAMESS v. 7.0.4 benchmarks and scalability on SKIF K-1000 (another large Opteron Infiniband Linux cluster) page . Press to visit PC GAMESS v. 7.0.4 benchmarks and scalability on 21-node Pentium 4 Infiniband Linux cluster page . ...

Еще в разделе: (Показать все результаты (>123) - classic.chem.msu.su/ )

• PC GAMESS v. 7.1.1 benchmarks and scalability on Infiniband Opteron Windows CCS
• PC GAMESS benchmarks and scalability on 21-node Infiniband Pentium 4 Linux
• PC GAMESS v. 7.0.4: Opteron Rev. E vs. Opteron Rev. F performance comparison

DAI Comparescan . ... Comparescan is a simulation comparison tool that compares a "golden" simulation set to another simulation set. Comparescan is a full featured comparison tool that computes far more than simple signal comparison. The comparison criteria is specified in a Comparison Rules File. ... Home Site: . ... Software/Hardware Requirements: . ... http://www.designacc.com/ (DAI Home Page) . ... SAL Home | Other Scientific Fields | Electrical Related Software . ...

Еще в разделе: (Показать все результаты (>6601) - www.sai.msu.su/ )

• SAL- Other Scientific Fields - Chemistry, Biology Related - Dotter
• SAL- Other Scientific Fields - Electrical Related Software - Gemini
• SAL- Other Scientific Fields - Chemistry, Biology Related - Swiss PDBViewer

... 21.02.2011 . ... Credit Copyright: morn1415 (YouTube) Explanation: How big is our Sun compared to other stars? In a dramatic and popular video featured on YouTube , the relative sizes of planets and stars are shown from smallest to largest. ... Note that the true sizes of most stars outside of the Sun and Betelgeuse are not known by direct observation, but rather inferred by measurements of their perceived brightness , temperature , and distance. ... Publications with keywords: star - planet . ...

Еще в разделе: (Показать все результаты (>17255) - www.astronet.ru/ )

• Inside the Coma Cluster of Galaxies
• Galaxy Cluster A2199
• Journal "Peremennye Zvezdy"

... Shapley H. - Studies of Magnitudes in Star Clusters VI. The Relation of Blue Stars and Variables to Galactic Planes . ... Название: Studies of Magnitudes in Star Clusters VI. ... Автор: Shapley H. Язык: . ...

Еще в разделе: (Показать все результаты (>12730) - lib.mexmat.ru/ )

• Oort J.H. - On a Possible Relation between Globular Clusters and Stars of High
• Barus C. - On a Comparison of the Relative Sensitiveness of Telephones ::
• Shapley H. - Studies of Magnitude in Star Clusters VII. A Method for the

... On peculiarities of using heterogeneous cluster architecture for solving continuum mechanics problems" . Gubaidullin D.A., Nikiforov A.I., Sadovnikov R.V. The use of high-performance computing systems built on the basis of NVIDIA graphics processors is discussed. ... Keywords: parallel computing, graphics processors, iterative Krylov subspace methods, method of control volumes, flow in porous media . PostScript (in Russian) (5.82MB) . PDF (in Russian) (658KB) . ...

Еще в разделе: (Показать все результаты (>463) - num-meth.srcc.msu.ru/ )

• "The 3D-computer cluster simulation of forming the large-sized one-piece
• "Integration of Fuzzy c-Means Clustering algorithm with PostgreSQL database
• "Solving the Boltzmann kinetic equation using tetrahedral meshes on a cluster

. Kudryashov S.I. , Zorov N.B. Mendeleev Communications, p. 178 (1998). Abstract . The electric probe procedure developed here has made it possible to detect for the first time large cluster ions, the products of spinodal decomposition of the laser-induced labile state of the liquid phase of carbon, with a size up to a million atoms and relative content in the mass distribution of the order of ppm. Laboratory of Laser Diagnostics

Еще в разделе: (Показать все результаты (>811) - chem.msu.ru/ )

• Determination of Reaction Rate Constants in Micelles. A Comparison of the

Application of evolutionary model in the evaluation of the quality of pair wise alignment of amino acid sequences Valery Polyanovsky, V. G. Tumanyan Engelhardt Institute of Molecular Biology, Russian Academy of Sciences, Moscow, 119991 Russia ... : polyanovskyvo@mailfrom.ru, tuman@eimb.ru The purpose of the work is to develop a universal method for estimating the pairwise alignment quality depending on the evolutionary distance (degree of homology) between the ... REFERENCES 1. ...

Еще в разделе: (Показать все результаты (>278) - mccmb.belozersky.msu.ru/ )

• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/129.pdf
• http://mccmb.belozersky.msu.ru/2015/proceedings/abstracts/106.pdf
• http://mccmb.belozersky.msu.ru/2013/abstracts/abstracts/215.pdf

... This RFC is the first in a new sub-series of RFCs called FYIs (For Your Information). This memo provides information for the Internet community. ... Distribution of this memo is unlimited. The FYI series of notes is designed to provide Internet users with a central repository of information about any topics which relate to the Internet. ... The FYIs are intended for a wide audience. ... New FYIs are announced to the RFC distribution list maintained by the SRI Network Information Center (NIC). ...

Еще в разделе: (Показать все результаты (>19828) - mirror.msu.net/ )

Find Similar Abstracts . ... The velocity of clusters of galaxies relative to the microwave background. ... BACKGROUND RADIATION, GALACTIC CLUSTERS, MICROWAVE SCATTERING, VELOCITY MEASUREMENT, HIGH TEMPERATURE GASES, MICROWAVES, POLARIZED RADIATION, RADIAL VELOCITY, RADIO ASTRONOMY, THOMSON SCATTERING . ... Use: Authors Title Abstract Text Text Query with Keywords Return: Query Results Query Form Database: Astronomy Instrumentation Physics and Geophysics ABSTRACT QUERY USER FEEDBACK HELP ...

Еще в разделе: (Показать все результаты (>502) - xray.sai.msu.ru/ )

• The COOC Criterion (Criterion of Observations versus Calculations)
• Restrictions on the Scenario Parameters
• Discussion and conclusions

COMPARISON OF CLUSTERING ALGORITHMS FOR SPEAKER IDENTIFICATION Nikolay Lubimov, Evgeny Mikheev, Alexey Lukin Moscow Lomonosov State University, Moscow, Russia In this paper we consider the problem of text-independent speaker identification that refers to acoustic recognition research. ... We have performed the comparison of different clustering methods for speaker identification: the standard K-means clustering, K-means++, Linde-Buzo-Gray, Fuzzy C-means, and Gustafson-Kessel algorithms. ...

Еще в разделе: (Показать все результаты (>210) - imaging.cmc.msu.ru/ )

Contents. planet: 5 - Jupiter satellites: J1 - Io : 81, J2 - Europa : 24, J3 - Ganymede :129, J4 - Callisto : 36 total number: 270 type: relative dates: 1996-1997 observatory: see observatories list in the comments Reference. Emelianov N. V., Vashkovjak S. N. (2009) Astrometric results of the observations of the mutual occultations and eclipses of the Galilean satellites of Jupiter in 1997. ... X coordinate in arcseconds (topocentric for mutual occultation or heliocentric for mutual eclipse) 10. ...

Еще в разделе: (Показать все результаты (>386) - lnfm1.sai.msu.ru/ )

• jg0020
• jg0021
• jo0017

... E-MAIL ADDRESS: D.Khmelev@newton.cam.ac.uk . A new statistical method in the analysis of literary style for disputed authorship resolution is considered here. ... Consider a sequence of letter of text as a Markov chain. ... Suppose we take the logarithm of each probability, change a sign, and divide it by the length of control text; then each of the numbers obtained is called the relative empirical entropy . Relative empirical entropy is more convenient for computing than actual probabilities. ...

Еще в разделе: (Показать все результаты (>58) - old.philol.msu.ru/ )

... About lab . ... The LidarK library provides an open-source framework for processing multidimensional point data such as 3D LIDAR scans. ... Download LidarK 2.0 , or browse for the previous versions and data samples . ... We called the data structure we designed Seg-Tree . ... GML LidarK Library v. 2.0 September 10, 2010 Download . GML LidarK Library v. 1.2 December 5, 2008 Download . GML LidarK Library v. 1.1 September 9,2008 Download . GML LidarK Library v. 1.0 July 1, 2008 Download . ...

Еще в разделе: (Показать все результаты (>231) - graphics.cs.msu.ru/ )

• GML LidarK Library | Лаборатория компьютерной графики и мультимедиа

Execution performance of NAS tests . The tables, presented below, contain information about sizes and performance of MPI-programs and DVM-programs for NAS tests. ... Performances of DVM-programs and MPI-programs are comparable. ... Second, MPI-versions of some tests use parallelization along two dimensions of processor grid, whereas DVM-versions of all tests are performed now only on a line of processors. ... RCC-cluster Pentium III/500 + SCI, . ... BT test execution times in seconds (class A) . ...

Еще в разделе: (Показать все результаты (>149) - sp.cs.msu.ru/ )

• DVM-system. Goals and structure

... Related tools . Up: Debugging MPI programs Next: Contents of the library files Previous: Attaching debugger to a running program . The Scalable Unix Tools (SUT) is a collection for managing workstation networks as a MPP. These include programs for looking at all of the processes in a cluster and performing operations on them (such as attaching the debugger to every process you own that is running a particular program). ... Центры . ...

Еще в разделе: (Показать все результаты (>470) - www.parallel.ru/ )

• Attaching debugger to a running program | PARALLEL.RU -
• Difference between workstation clusters and MPPs | PARALLEL.RU -

. of Lomonosov Moscow State University, . Russia . GCVS Research Group . Catalogues of Variable Stars . Future Prospects of Variable-Star Catalogues . B.V. Kukarkin Centenary Conference: Variable Stars, the Galactic Halo and Galaxy formation (VS-Halo) . What's new . Recent publications . Digitization of Moscow Plate Archive . The "Peremennye Zvezdy" (Variable Stars) journal . Send questions and comments to Olga Durlevich .

Еще в разделе: (Показать все результаты (>115) - sai.msu.ru/ )

ABSOLUTE PROPER MOTIONS OF 331 OPEN CLUSTERS . ... The proper motions of stars in the fields of 331 open clusters were taken from Four-Million Star Catalog (4M-catalog) of positions and proper motions (Volchkov et al. ... The absolute proper motions for 21 young open clusters have been derived by comparison of precise relative proper motions of individual stars and their corresponding absolute proper motions. ... Sign of proper motions in RA . ... 0.0001 arcsec/yr . ... rms error in RA proper motion . ...

Еще в разделе: (Показать все результаты (>36) - www.sai.msu.ru/ )

Lomonosov Moscow State University was established in 1755 . ... Lomonosov Moscow State University Diary . ... MSU Online . ... More than 40 000 students (graduate and postgraduate) and about 7 000 undergraduates study at the university, and over 5 000 specialists do the refresher course here. ... Moscow University campus is an extremely complex system, with its 1 000 000 m2 floor area in 1 000 buildings and structures, with its 8 dormitories housing over 12 000 students and 300 km of utility lines. ...

Еще в разделе: (Показать все результаты (>195) - www.msu.ru/ )

... CommentPlugin . This plugin allows users to quickly post comments to a page without an edit/preview/save cycle. ... Default templates . ... The target attribute may specify a web, and may also specify an anchor within the target topic; for example, %COMMENT{type="above" target="%MAINWEB%.PersonalRemarks#InsertHere"}% This uses a standard TWiki in-topic anchor as the insertion location. ... The plugin picks up these template definitions from a standard TWiki template file, templates/comments.tmpl . ...

Еще в разделе: (Показать все результаты (>39143) - dualopt1.cmm.msu.ru/ )

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>214) - www.genebee.msu.ru/ )

• OUTPUT
• AliComp - GeneBee Alignments Comparison - Advanced
• DIMACS Series in Discrete Mathematics