... Faculty of Bioengineering and Bioinformatics of Moscow State University, Moscow, Russia ( link ) . Engelhardt Institute of Molecular Biology, Moscow, Russia ( link ) . Belozersky Institute of Moscow State University, Moscow, Russia ( link ) . ...

Еще в разделе: (Показать все результаты (>20) - mouse.genebee.msu.ru/ )

• Align tool for DNA-protein complexes
• ConClus
• Nhunt

... 9) Oknyanskij V.L. 1994, "Optical-radio time delays in Q0957+561", Odessa Astronomical Publ., ... 11) Oknyanskij V.L. 1994, "Connection between X-ray and optical variability in NGC4151", in Proceedings of Int. Conf. ... 1994. 12) Oknyanskij V.L. 1994, "Connection between X-ray and optical variability in NGC4151", Astrophys. and Space Science, 222, p.157. ... 14) Oknyanskij V.L., van Groningen E., 1997, "Optical spectral variability of NGC4151 in 1990", Astronomical and Astrophys. ...

Еще в разделе: (Показать все результаты (>12) - uranus.sai.msu.ru/ )

• SAI graduates 1982

... Voronov, Vasiliy. Scalability and efficiency of parallel power grid simulations on massively-parallel platforms (submitted). ... 2009. ... Voronov, Vasiliy and Popova, Nina. ... Conference proceedings 2010. ... Abstract Book of SIAM Conference on Parallel Processing for Scientific Computing (SIAM PP10). ... Proceedings of the International Conference on Parallel Computing (ParCo-2009). ... IEEE Computer Press. ... Pozdneev, Alexander and Popova, Nina and Voronov, Vasiliy. ...

Еще в разделе: (Показать все результаты (>5) - angel.cmc.msu.ru/ )

... Н.И. Леонюк. ... O.V. Pilipenko, V.V. Maltsev, E.V. Koporulina, N.I. Leonyuk, N.A. Tolstik, N.V. Kuleshov. Growth of (Yb,Er):YAl3(BO3)4 laser crystals. ... Journal of Crystal Growth (in press). ... Highly efficient Er- and Yb-doped YAl3(BO3)4 laser material: crystal growth and characterization. ... Crystal growth of highly efficient oxide materials from high-temperature solutions. 4th Asian Conference on Crystal Growth and Crystal Technology (CGCT-4), Sendai, Japan, May 21-24, 2008 (accepted). ...

Еще в разделе: (Показать все результаты (>37) - cryst.geol.msu.ru/ )

• http://cryst.geol.msu.ru/literature/2008.php/
• http://cryst.geol.msu.ru/literature/lit_kuch.php
• http://cryst.geol.msu.ru/literature/2006.php

... Japan Tobacco International (JTI) ведущая табачная компания на российском рынке, в ее портфеле три из десяти самых продаваемых брендов в стране. ... JTI в России с 2007 года лидер табачной отрасли 1 и крупнейшая компания FMCG-сектора 2 . ... Компания JTI один из лучших работодателей России по версии всероссийских рейтингов 3 . ... 1 По данным компании Nielsen за период январь 2016 г. 2 По данным рейтинга журнала Эксперт 400 крупнейших компаний России 2015 по объему реализации продукции , 2015 г . ...

Еще в разделе: (Показать все результаты (>125) - www.physcareer.ru/ )

• Вакансии компании Japan Tobacco International / Physcareer.ru
• Программа стажировок JUMP, компания Japan Tobacco International / Стажировки /
• Гранты для обучения в Великобритании (Chancellor's International Research

... M.V.Lomonosov Moscow State University . ... Junior Scientific Researcher, Senior Scientific Researcher, Leading Scientific Researcher, Department of Inorganic Chemistry, Chemistry Faculty of Lomonosov Moscow State University . ... Head of the Inorganic Crystal Chemistry Laboratory, Department of Inorganic Chemistry, Chemistry Faculty of Lomonosov Moscow State University . ... Professor of the Department of Inorganic Chemistry, Chemistry Faculty of Lomonosov Moscow State University . ...

Еще в разделе: (Показать все результаты (>91) - electr003.chem.msu.ru/ )

• In memory of Sasha Kuznetsov
• Liana N. Sviridova:CV
• Elena V. Stenina:CV

. [ Войти ] . Главная -> Фильмы -> The International . Пользователи . Демо . Деньги . Фильмы . Форум . The International . Интернэшнл . Германия - США - Великобритания 2009 . отметить . Триллер . Драма .

Еще в разделе: (Показать все результаты (>552) - kinfo.ru/ )

• International Khiladi - Фильмы - Kinfo.ru
• Lovespring International - Фильмы - Kinfo.ru
• Austin Powers: International.. - Фильмы - Kinfo.ru

Described below are two methods for preparing input files with basis sets and ECPs which are not currently built in. ... Put basis sets and ECPs in directories (called here def2_svp_BAS and def2_ecp_ECP but you can call them whatever you want) and copy them to the Firefly directory. ... Both methods can also be used for preparing gamess (us) files - the check runs may not terminate properly due to certain keywords, but a useable file called 'input' is normally generated. ...

Еще в разделе: (Показать все результаты (>75) - classic.chem.msu.su/ )

• Firefly documentation - state-specific gradients for state-averaged MCSCF and

... on Information and Communication Technologies in Foreign Language Teaching , . ... The Scientific and Methodological Council on Foreign Language Teaching . ... The Faculty of Foreign Languages of Lomonosov Moscow State University . The Distance Education Centre (DECent) . ... Teaching and learning a foreign language at a distance. Developing and using online distance language courses. ... The role of the tutor in a distance education language course. Working languages English and Russian. ...

Еще в разделе: (Показать все результаты (>16) - anazarenko.ffl.msu.ru/ )

• Дистанционные курсы

... Полная версия: international, supadance, ray rose . Грация-МГУ::Форум > Дискуссии > Танцевальная жизнь > Танцевальная обувь . ... Oct 30 2006, 15:11 . ... Последний стандарт - Ray Rose. ... Nov 3 2006, 15:21 . Цитата(scarler @ Oct 30 2006, 15:11) . ... Не подскажете, можно ли заказать Ray Rose по и-нету? Говорят, их можно купить только в Англии . ... Цитата(Ира @ Nov 3 2006, 16:21) . ... Цитата(scarler @ Nov 9 2006, 15:55) . ... Nov 15 2007, 09:42 . ... Oct 14 2009, 23:01 . ...

Еще в разделе: (Показать все результаты (>43) - grace.msu.ru/ )

• Грация-МГУ::Форум > Чемпионат России по танцам! Hip-hop international
• Грация-МГУ::Форум > III Всероссийский Чемпионат Hip Hop International - Кубок
• Чемпионат России по танцам! Hip-hop international - Грация-МГУ::Форум

Curriculum Vitae of Dr Alexei A. Mailybaev . ... A.P. Seyranian and A.A. Mailybaev, Multiparameter Stability Theory with Mechanical Applications , World Scientific, New Jersey, 2004. ... A.A. Mailybaev and A.P. Seyranian, Bifurcations of equilibria in potential systems at bimodal critical points, Journal of Applied Mechanics 75 (2008), 021016. ... A.P. Seyranian and A.A. Mailybaev, On stability boundaries of conservative systems, Journal of Applied Mathematics and Physics (ZAMP) 52 (2001), 669-679. ...

Еще в разделе: (Показать все результаты (>30) - mailybaev.imec.msu.ru/ )

... My field of specialization is Stability Theory, Nonlinear Dynamics, Asymptotic Methods, Mechanics of Solids, System Identification, Optimal Control, Economic Growth. ... A.O. Belyakov and A.P. Seyranian (2012). ... A.O. Belyakov and A.P. Seyranian, . ... A.P. Seyranian and A.O. Belyakov, Swing dynamics. ... A.O. Belyakov, A.P. Seyranian, and A. Luongo, Regular and chaotic dynamics of the swing. 6th EUROMECH Nonlinear Dynamics Conference (ENOC 2008) , Saint Petersburg, Russia, June, 30 - July, 4 2008...

Еще в разделе: (Показать все результаты (>10) - belyakov.imec.msu.ru/ )

... Proceedings of International Congress of Acid Snow and Rain 1997 (Acid Snow and Rain) , 1997, Niigata, Japan, October 6-8, 1997. ... Long-term and short-term response to acid deposition of poor sandy podzols under pine and birch forests near the nickel smelter in the Kola Peninsula, the north-western part of Russia, was evaluated with the SMART model. The present acid load does not effect considerably on forest soils in background areas. ...

Еще в разделе: (Показать все результаты (>36) - eco.soil.msu.ru/ )

• Forest Soil Response to Acid Deposition
• Forest ecosystem data in Norwegian-Russian border area
• TRANSFORMATION AND STABILITY OF SOILS IN FOREST ECOSYSTEMS UNDER IMPACT OF

... M.S. in Physics, entitled "Hyper-Rayleigh Scattering On Third and Second Harmonics In Silver Island Films", Moscow State University, 2003 with honor. ... Didenko N.V., Kim E.M., Muzychenko D.A., Nikulin A.A., and Aktsipetrov O.A. "Structural studies of silver island films probed by hyper-Rayleigh scattering and atomic force microscopy", Surf. ... Kim E.M., Elovikov S.S., Aktsipetrov O.A., "Surface enhanced third harmonic generation in silver island films", Proceeding's of SPIE 48, Vol 5222A, 2003. ...

Еще в разделе: (Показать все результаты (>34) - shg.phys.msu.ru/ )

• International Cooperation Info

... Пользователи -General- Common Current University Society Study Diaspora FAQ Real Estate -Technical- Development Hard&Soft Network Mobile -Market- Market Services Job -Hobby- Behemoth Health Love&Sex Еда Media Games Auto&Moto Sport Hobby Flood Zone -Servant- Alternative Forums Forum -Garbage- Revolution Garbage Private . ... Re: Формула 1, Гран-При Китая, Shanghai International Circuit, 17-19 о [ re: SuperBizZzon ] . ...

Еще в разделе: (Показать все результаты (>2532) - www.fds-net.ru/ )

• Вопрос о работе трейдером в компании Tycoon International Trading Ltd - Public
• Формула 1, Гран-При Японии, Fuji International Speedway, 10-12 октября - Public

General Information . ... Scientific research . ... For physics faculty . ... Department of General Physics and Magneto-Ordered Matter is one of the largest Chairs of Physical Faculty of Lomonosov Moscow State University with long-standing traditions and a numerous community of high qualification teaching personnel and researchers, performing research in the most actual fields of condensed matter physics and teaching graduates in magnetic and ferroelectric phenomena. ...

Еще в разделе: (Показать все результаты (>32) - ferro.phys.msu.ru/ )

• Physics Fuculty of Moscow State University
• Physics Department of Moscow State University
• Untitled

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>8) - storage.bioinf.fbb.msu.ru/ )

... Institute of Mechanics . ... In 1977- 1991 A .P.Seyranian was a Member of Scientific Staff at the Institute of Problems in Mechanics of the Academy of Sciences in Moscow . ... Since 1993 A .P.Seyranian is a Leading Researcher and Professor of the Institute of Mechanics , Moscow State Lomonosov University . ... In 2003 he became an Invited Speaker and Chairman of the Session 'Stability and Control Problems in Mechanics' at the conference 'Physics and Control 2003' , Sankt-Petersburg. ...

Еще в разделе: (Показать все результаты (>3) - seyranian.imec.msu.ru/ )

• List of Publications of Prof. Alexander P. Seyranian

... Т.А. Власова. ... T.A. Vlassova. ... Acta horticularae, 1994, 381, (Proc. of International Symposium on Natural Phenols in Plant Resistance, 13-17 Sept. ... In: Modern fungicides and antifungal compounds 11, Intercept LTD, Andover, U.K.,( Proc of 12th International Symposium, Castle of Reinhardsbrunn, Germany, May 24-29, 1998), P.242-245. ... In: Modern fungicides and antifungal compounds (14th International Symposium, Castle of Reinhardsbrunn/Friedrichroda, Germany, April 25-29, 2004, Abstracts). ...

Еще в разделе: (Показать все результаты (>32) - plantphys.bio.msu.ru/ )

• Брейгина Мария Александровна

... Публикации . ... О ВШГА МГУ . ... ВШГА МГУ - это подготовка кадров среднего и высшего звена для органов государственной власти РФ, крупных государственно-частных корпораций и бизнес-структур. ... Журнал "ПРОЕКТНОЕ ФИНАНСИРОВАНИЕ - INTERNATIONAL AND RUSSIAN PROJECT FINANCE" . В журнале "ПРОЕКТНОЕ ФИНАНСИРОВАНИЕ - INTERNATIONAL AND RUSSIAN PROJECT FINANCE", ?6 (006) 2010г. опубликованы статьи администрации, профессорско-преподавательского состава и студентов ВШГА МГУ . ... Новости и публикации | ...

Еще в разделе: (Показать все результаты (>19) - anspa.msu.ru/ )