... David Kirk/NVIDIA and Wen-mei W. Hwu , 2007-2012 ECE408/CS483, University of Illinois , Urbana-Champaign 14 CUDA Device Memory Management API functions · cudaMalloc() ­ Allocates object in the device global memory ­ Two parameters · Address of a pointer to the allocated object · Size of of allocated object in terms of bytes ( Device ) Grid Block (0, 0) Block (0, 1) Registers Registers Registers Registers · cudaFree() ­ Frees object from ...

Еще в разделе: (Показать все результаты (>6) - ccoe.msu.ru/ )

• http://ccoe.msu.ru/sites/default/files/RU_Apps_Catalog_Sep13_LR.pdf
• The NVIDIA Graduate Fellowship Program | GPU Center of Excellence МГУ

... Master Degree in Geology . Master Degree in Management . Master Degree in Chemistry . ... 29 марта 2016 г. День открытых дверей Высшей школы инновационного бизнеса . ... T he goal of this Master Degree program is to educate specialists with the knowledge of the newest technologies of geological study, modeling and development of deposits, advanced scientific methods of seismic and geophysical exploration, geophysical well-logging, production enhancement, etc. ...

Еще в разделе: (Показать все результаты (>5) - www.hsib.msu.ru/ )

• General information | Высшая школа инновационного бизнеса МГУ
• Master Degree in Chemistry | Высшая школа инновационного бизнеса МГУ
• Master Degree in Management | Высшая школа инновационного бизнеса МГУ

... Выпускники . Выпускники ВМиК . ... Женский клуб . ... Издательство МГУ . ... Выпускники МГУ . ... Дайв-Клуб МГУ . ... Senior IFP Fall 2005 . The Center on Philanthropy and Civil Society's Senior International Fellows Program provides an opportunity for the professional development of Third-Sector practitioners from outside the United States who are decision makers in their professions. The program is designed to help build Third-Sector capacity in the Fellows' home countries. ...

Еще в разделе: (Показать все результаты (>487) - www.moscowuniversityclub.ru/ )

• Клуб выпускников МГУ: International Fellows Program
• Клуб выпускников МГУ: Nyg?rd использует стволовые клетки для достижения
• Клуб выпускников МГУ: CRISIS IN THEORETICAL PHYSICS: THE PROBLEM OF SCIENTIFIC

... Event generation+Geant simulation of detector) For this, do you need a sophisticated baseline model of your event generator ? ... How to produce heavy state in PYTHIA? ... 350 (2001) EPOS for pp 15 MPI@LHC 2011, DESY, Hamburg, Klaus WERNER, Subatech, Nantes EPOS for heavy ion 16 Same framework extended pp AB EPOS for heavy ion 17 In heavy ion collision / or very high energy pp scattering : The usual procedure has to be modified, since the density of strings will be so ...

Еще в разделе: (Показать все результаты (>53) - lav01.sinp.msu.ru/ )

• http://lav01.sinp.msu.ru/rdmscms/bul1.html
• http://lav01.sinp.msu.ru/~vlk/UPC_2002.pdf
• Etapi- Comments 3/1/97

... More Reports . ... Variety of long-eared owls (Asio otus) diet, as index of habitat usefulness // Mobility of students and programmes flexibility in the prospect of the European unification of the training processes in ecology and environmental science. ... Long-eared owl A.otus rather actively masters anthropogenous landscapes. In this connection it is interesting to observe change of various aspects of ecology of this species, in particular, dynamics of its food objects. ...

Еще в разделе: (Показать все результаты (>73) - vertebrata.bio.msu.ru/ )

• Выступления студентов и аспирантов на конференциях
• Education
• Department of Vertebrate Zoology

SAO is Russia's main centre for ground-based space research. ... The basic instruments of the Observatory are the optical telescope BTA (Big Alt-azimuth Telescope) with a main mirror diameter of 6 m and the radio telescope RATAN-600 with the antenna diameter 600 m. Study of the Universe as a whole, analysis of non-stationary energy release in galactic and extragalactic objects of various types, investigation of evolution and chemical composition of our Galaxy and the nature of solar activity. ...

Еще в разделе: (Показать все результаты (>20) - www.issp.ac.ru/ )

• Institutes of Chernogolovka
• Astronomy and Space Physics: Russian Federation Olympiads 1996-1999
• Chernogolovka

Discover the cosmos! ... 2000 December 29 . The Dark Horsehead Nebula . ... Image Processed by Al Kelly . Explanation: While drifting through the cosmos this magnificent interstellar dust cloud, sculpted by stellar winds and radiation, has chanced to assume a recognizable shape. Fittingly named The Horsehead Nebula it is embedded in the immense complex of star forming gas and dust surrounding the Orion Nebula some 1,500 light-years distant. ... About APOD | ...

Еще в разделе: (Показать все результаты (>132) - www.arcetri.astro.it/ )

• APOD: 2000 December 15 - IC443's Neutron Star
• APOD: February 7, 1998 - COBE Hotspots: The Oldest Structures Known
• APOD: June 25, 1996 - A Star Forming Region in the LMC

... This technology presumes that blood sampling is performed by patient himself, the sample is spotted on a dry, as a rule, porous surface (filter paper, cellulose acetate membrane, etc.), and the posterior transportation to a laboratory, for example, by post in a standard or a special envelope. ... Under the dried blood spot technology using, the problem of the sample spotted volume determination remains one of the main practical questions. ... The problem is to find a function f (y1 , y2 , . ...

Еще в разделе: (Показать все результаты (>174) - higeom.math.msu.su/ )

• Alexey Garber
• Topology section
• Special courses (Russian)

Search of Novel Crystalline Materials , Study of their Properties and Crystallization Processes . ... The work of group for the search of novel crystalline materials are held at M.V. Lomonosov Moscow State University since 1964. The main aim of investigations are search and study of new promising multifunctional materials with unusual physical properties: ferroelectrics, superionic conductors, nonlinear optical materials, laser crystals, piezoelectrics, etc. ...

Еще в разделе: (Показать все результаты (>4) - newcryst.phys.msu.ru/ )

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>12) - storage.bioinf.fbb.msu.ru/ )

... 12(1): 3338 ї RUSSIAN JOURNAL OF THERIOLOGY, 2013 A method of preparation of osteological specimens of mammals and birds Vyacheslav A. Solovev*, Aleksei A. Sergeyev, Andrei S. Zhiryakov & Tatyana L. Rukavishnikova ABSTRACT. ... Number of treated biological material. ... Results and discussion It is known a few main methods of skulls and bones preparation in laboratory such as: boiling in water, maceration by rotting, cleaning with protein enzymes solution, and cleaning by dermestid beetles larvae. ...

Еще в разделе: (Показать все результаты (>1370) - zmmu.msu.ru/ )

• http://zmmu.msu.ru/files/images/spec/Russ%20Ent%20J/ent20_3%20315_319%20Reznikova%20for%20Inet.pdf
• Birds of Moscow and the Moscow Region
• Epigenetic variation of the common shrew, Sorex araneus, in different habitats

... One of the project objectives was to investigate practical efficiency of some modern iterative methods, including multigrid techniques and domain decomposition methods as well as methods for small compressible materials. ... Hence, the project research initiated because of INTAS financial support contributes in setting up modern computational techniques in tire design. ... Research on efficiency of iterative methods was conducted at the department of Mechanics of Composites about ten years ago. ...

Еще в разделе: (Показать все результаты (>4) - composite.msu.ru/ )

• Department of the Composites Mechanics

... The philosophical consequences of synergetics, the interdisciplinary theory of evolution and self-organization of complex systems, are being drawn in the paper. ... Key words: complex systems, evolution, nonlinearity, pre-determination, self-organization, soft management, structure-attractors, synergetics 1. ... The spectra of possible, `allowed' structures correspond to sets of the eigenfunctions of the nonlinear equations describing the evolutionary processes in the complex system. ...

Еще в разделе: (Показать все результаты (>19) - www.students.chemport.ru/ )

First-principles calculations of nonlinear optical properties of undoped and Zr- and Nb-doped KTiOPO4 A. I. Lebedev Physics Dept., ... In this work, the structure of the ferroelectric phase in undoped KTP and its solid solutions doped with zirconium and niobium is calculated within the density functional theory, and the second-order nonlinear susceptibility tensor and spontaneous polarization are calculated for these crystals. ... Comp onent d33 d24 = d32 d31 = d15 This work 15.06 4.51 1.19 Ref. ...

Еще в разделе: (Показать все результаты (>86) - scon155.phys.msu.su/ )

• Laboratory of Semiconductor Optoelectronics
• Kinetics of domain structure in ferroelectric thin films
• First-principles calculations of physical properties of crystals

... Master . ... SAI MSU . Conference was supported by PLC "MO "OPTIKA" . ... Morning session . Chair Hugo Levato (ICATE, Argentina) . ... Vladimir Lipunov ( MSU , SAI ) . ... Evgeniy Gorbovskoy (MSU, SAI) & . А lexander Belinskiy (MSU, SAI) . ... Chair Claudio Mallamaci (OAFA, Argentina) . ... Using MASTER Net in the MSU educational process . ... Chair Victor Kornilov (MSU, SAI) . ... Nikolay Budnev (ISU ) . ... Excursion to the Moscow Kremlin . ... Joint MASTER and Russian Pereplet session. ...

Еще в разделе: (Показать все результаты (>18) - master.sai.msu.ru/ )

LOCAL TSUNAMI WARNING AND MITIGATION ________________________________________________________________________________________________________________________________________ THE NEW GRIDDED KURIL-KAMCHATKA BATHYMETRY FOR TSUNAMI MODELING An. ... For calculations in each grid point where the depth is to be found the algorithm uses up to 9 points from data source. ... Then the spline interpolation is used for defining the depth value in the grid-point. ... Hydrographic Survey Data, CD-ROM data set, Ver. ...

Еще в разделе: (Показать все результаты (>30) - seac47-2.phys.msu.ru/ )

• LOCAL TSUNAMI WARNING AND MITIGATION -- Official information

Characterization of Mumijo (Shilajit) from Different Regions by FTICR Mass-Spectrometry Alexey Kononikhin1, Gleb Vladimirov1, Erast Kunenkov2,Irina Perminova2, Igor Popov1, Andrey Garmash2, Eugene Nikolaev1 1 The Institute for Biochemical Physics Russian Academy of Science, Moscow, Russia, Department of Chemistry, Lomonosov Moscow State University, 119992, Moscow, Russia nikolaev@chph.ras.ru 2 Keywords: mumijo, mumie, shilajit, FTICR mass-spectrometry 1. ...

Еще в разделе: (Показать все результаты (>178) - mgumus.chem.msu.ru/ )

• http://www.mgumus.chem.msu.ru/publication/2008/2008-nikolaev-development.pdf
• MGUMUS -- Second International Conference of CIS IHSS on Humic Innovative
• The program of the ARW

... Robert Hermann Brookline, MA (Received November 22, 1999) der to illustrate the obvious progress, one can mention a variety of examples. ... In or- FYI Item "BMS Report on Institutes" As a member of the panel commissioned by the Board on Mathematical Sciences of the National Research Council, I write to correct several inaccuracies in the "For your information" note by Allyn Jackson entitled "BMS Report on Institutes" in the December 1999 issue of the Notices. ...

Еще в разделе: (Показать все результаты (>76) - chaos.phys.msu.ru/ )

• Research interests
• Alexey Ryabov. Research

... The applied mathematics (with Honors), Kazan State University, Kazan, Russia (USSR), 1980. nd Alexander Lazarev Research Interests Discrete optimization: combinatory problems, modeling, decomposition algorithms, applications to production planning and scheduling. ... Kazan, Publishing house of the Kazan mathematical society, 1998. - 285 p. Lazarev A.A., Gafarov E.R. Scheduling Theory. ... Computer centre of the Russian Academy of Sciences - 2006. - 134 p. Lazarev A.A., Gafarov E.R. Scheduling Theory...

Еще в разделе: (Показать все результаты (>8) - physcontrol.phys.msu.ru/ )

About SPAW Editor . ... As of final version 1.0 of the control you'll need to rename the file spaw_control.default.config.php in config sub-directory to spaw_control.config.php when installing control for the first time. ... All of the SPAW Editor configuration options are located in the config/spaw_control.config.php file. ... This file will be included in img_library.php (Image library dialog script). $request_uri variable will be set to the URL of the page where SPAW Editor instance resides. ...

Еще в разделе: (Показать все результаты (>3) - textbook.sinp.msu.ru/ )