... 4) ICSSNP, Russian Academy of Sciences, 12-16 Nov 2012 , MEPhI , Moscow , Russia Vladimir Korotkikh , Flow and Ridge at CMS 4 Ridge in PbPb at high pT ( 2012 ) Slide taken WeyLi's INTRidje 2012 talk Vladimir Korotkikh , Flow and Ridge at CMS ISNP, Russian Academy of Sciences, 12-16 Nov 2012 , MEPhI , ... Vladimir Korotkikh,"Flow and Ridge at CMS" Is it a common and not coincidental property of QGM ? What is a physical origin of it in Flow and Ridge phenomena ? ...

Еще в разделе: (Показать все результаты (>32) - lav01.sinp.msu.ru/ )

... MSU Chamber Orchestra . ... G .F. Handel. Cara sposa" - Symphony and Air of Rinaldo. G.F.Handel "Mi credi in fedele.. Air of Siroe . ... Air of Goffredo from "Rinaldo". ... Moscow State University Chamber Orchestra. Handel and Graupner . ... Soprano air from "Messiah" . G.F. Handel "Il vostro maggio.. Song of Syrenes from "Rinaldo") . G. F. Handel - Theodora - "To thee, thou glorious son of worth.. G.F.Handel - Orlando - "Fammi combattere" . ...

Еще в разделе: (Показать все результаты (>24) - music.genebee.msu.ru/ )

. АННОТАЦИЯ . ABSTRACT . ПРЕДИСЛОВИЕ . PREFACE . CONTENTS .

Еще в разделе: (Показать все результаты (>34) - num-anal.srcc.msu.ru/ )

Членова С.Ф. Диалогическая природа художественных произведений // Международная междисциплинарная научно-практическая конференция 'Понимание в коммуникации - 5'. ... Московский городской педагогический университет, 15-17 февраля 2011 г. http://asp-ifl.ru/Content/Documents/2011-02-04-01.pdf . ...

Еще в разделе: (Показать все результаты (>43) - srcc.msu.ru/ )

• University Information System RUSSIA
• Членова С.Ф. 24 апреля Нине Александровне Дмитриевой исполнилось бы 95 лет //

e-mail: Irina.pronevskaya@mail.ru ) , , , , , - , , , , , , , , sociology of the family, family structure, family roles, Familism, familistic researches, macro and micro levels of analysis, SYMBOLIC INTERACTIONISM, Phenomenology, structural functionalism, conflict theory, quantitative research techniques, content analysis, qualitative research techniques , , , . ... Qualitative techniques enrich sociological researches of social macro processes and functioning of social institutions. ...

Еще в разделе: (Показать все результаты (>25) - vestnik.socio.msu.ru/ )

• http://www.socio.msu.ru/vestnik/archive/2011/1/13.pdf
• http://www.socio.msu.ru/vestnik/archive/2011/3/09.pdf
• http://www.socio.msu.ru/vestnik/archive/2012/1/08.pdf

. Fig. 3. Dependence of km on surface irradiance I(0). Solid and dashed lines shows km value averaged over 23 stations the Baltic Sea and band of standard deviation accordingly. Designations: 1 - km > 7*10 -5 ; 2 - km < 7*10 -5 . Fig. 4. The dependence of I 1/2 m on the average chlorophyll a content in water column and polynomial regression of this dependence (A). Histogram of distribution of the ratio of I 1/2 m to results of polynomial regression (B).

Еще в разделе: (Показать все результаты (>6) - www.biophys.msu.ru/ )

• Как отмечалось выше, обилие (по Fo) и фотосинтетическая активность

. Fatal error : Cannot redeclare get_category_tree() (previously declared in /home/virtwww/w_bukivedi-ru_fa80b1aa/http/templates/xtc4/source/boxes/categories_all.php:11) in /home/virtwww/w_bukivedi-ru_fa80b1aa/http/media/content/sitemap.php on line 50 .

Еще в разделе: (Показать все результаты (>7) - www.bukivedi.ru/ )

A. Gardziella, L. A. Pilato, A. Knop . ... The technical content of the book describes significant new phenolic resin chemistry, transformations and recent mechanistic pathways of resole and novolak cure. ... Also included in detail: Standardized test methods important for ISO 9001 ff certification. книга " Phenolic Resins: Chemistry, Applications, Standardization, Safety, and Ecology " . ...

Еще в разделе: (Показать все результаты (>22) - www.chemport.ru/ )

• "Оператор uplc, химик-аналитик." - вакансия в разделе "Работа для химиков"
• "Требуется химик-аналитик/оператор uplc" - вакансия в разделе "Работа для

CHECKLIST FOR OBSERVING PRESENTATIONS Group number_________________________________ |Points of |Scoring (1-10) |Explanation | ... attention of audience gained| | ... Body | logical sequence | ... Conclusion | ... conclusion is logical and | ... Delivery - |1 2 3 4 5 6 |language proficiency | ... Group |1 2 3 4 5 6 |consistent delivery style of| |interactions|7 8 9 10 |each presenter | ... Visual Aids |1 2 3 4 5 6 |persuasive slide titles | ... and items on slides | ... visual aids are creative | ...

Еще в разделе: (Показать все результаты (>44) - www.mgubs.ru/ )

• Выпуск 2/2011 | Высшая школа бизнеса МГУ им. Ломоносова
• Электронные библиотеки и ресурсы | Высшая школа бизнеса МГУ им. Ломоносова

May 12, 1998 NOTES from May 9, 1998: The format of the Solar Event Lists was changed to include a standard SEC style header. ... Please send comments and suggestions to sec@sec.noaa.gov # # Missing data: //// # # Edited Events for 1998 May 11 # # Event Begin Max End Obs Q Type Loc/Frq Particulars Reg# #------------------------------------------------------------------------------- 2560 A0146 //// 1225 HOL ... The UT day of the event's begin time is the UT day of the list. ...

Еще в разделе: (Показать все результаты (>21) - dbserv.sinp.msu.ru/ )

О лаборатории . ... Лаборатория теоретической биофизики . ... This Python module parses Gaussian cube files, produced by quite a few QM software packages, and makes volume data available as numpy array as well as some associated properties. ... Нет комментариев " Gaussian Cube files loader " . ... 2011 ERG Research Group . ...

Еще в разделе: (Показать все результаты (>28) - erg.biophys.msu.ru/ )

• Peter Mamonov ERG Research Group: Лаборатория теоретической биофизики
• Building and plotting Fukui function with FireFly and PyMol ERG Research Group:
• cp2k ERG Research Group: Лаборатория теоретической биофизики

... The linguistic aspects of the model and the properties of the semantic dictionary ensuring the content analysis with compression of the text structure are considered. Our dictionary resources serve an instru- ment for building a multilevel textual semantic structure. ... Reason (A,B), where SemF(A) = SIT or a whole semantic formula; the same for SemF(B). ... Sem(SIT)R . ... Semantic Resources for Textual Content Compression // Fourth International Conference on Meaning-Text Theory (MTT'09). ...

Еще в разделе: (Показать все результаты (>5) - leontyeva.srcc.msu.ru/ )

... Russian language courses: During academic year Summer courses Full-time Part-time Courses dates: from _____( day )____________( month )_____( year ) to ____( day )___________( month )______( year ) Information for visa support Citizenship __________________________________________(if more than one, please indicate them using comas) Place of birth ____________________________( country )_______________________________________ ____( ...

Еще в разделе: (Показать все результаты (>48) - www.msu.ru/ )

• http://www.msu.ru/science/details/2010/intel-rosnano-msu.doc
• http://www.msu.ru/science/details/2010/101021-moscow-wp2011.pdf

... http://www.aras.am/JENAM-2007/index.htm . ... JENAM 2007 in Armenia, First Announcement available                            J E N A M - 2 0 0 7                         "Our non-stable Universe"                    20-25 August 2007, Yerevan, Armenia JENAM-2007 (Joint European and National Astronomy Meeting) will take place in Yerevan (Armenia) and will be the 15th Annual Meeting of the European Astronomical Society (EAS) and the 6th Annual Meeting of the Armenian Astronomical Society (ArAS). ...

Еще в разделе: (Показать все результаты (>89) - sai.msu.ru/ )

... Вт Май 12 14:54:36 MSD 2009 . Следующее сообщение: PARALLEL.RU - Новости, специальный выпуск [21/05/2009] . ... OpenCL: язык параллельного программирования для ускорителей http ://agora.guru.ru/ parallel На сайте семинара выложены фотографии с доклада Дж.Донгарры The current state, trends, and future of supercomputing , состоявшегося 20-го апреля 2009 года. http ://agora.guru.ru/ parallel /photo/dongarra/ ------------- НОВОСТИ МИРА ВЫСОКОПРОИЗВОДИТЕЛЬНЫХ ВЫЧИСЛЕНИЙ http :// parallel.ru / ...

Еще в разделе: (Показать все результаты (>428) - mail.parallel.ru/ )

• PARALLEL.RU - Новости, выпуск #267 [09/06/2009]
• PARALLEL.RU - Новости, выпуск #339 [06/02/2013]
• PARALLEL.RU - Новости, выпуск #310 [14/06/2011]

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>13) - storage.bioinf.fbb.msu.ru/ )

• http://storage.bioinf.fbb.msu.ru/~roman/bmc_genom2_2013.pdf

... Multi-threaded search engines . ... Unfortunately, most documents on search engines I saw in the Internet were either lists of hyperlinks without any comments, or discussions about how many documents are in the database of ... (here is the name of a search engine) and what method of counting of the number of documents was used. No words about the efficiency, i.e. how many documents on some subject I can find using this search engine, especially in comparison with the other ones. ...

Еще в разделе: (Показать все результаты (>4) - scon155.phys.msu.ru/ )

JOURNAL OF APPLIED PHYSICS VOLUME 96, NUMBER 1 1 JULY 2004 Theoretical analysis of the synergism in the dielectric strength for SF6 у CF4 mixtures A. V. Larin ґ Laboratoire de Physico-Chimie Informatique, Facultes Universitaires Notre-Dame de la Paix, Rue de Bruxelles 61, B ... Calculated electron energy distribution function EEDF for the SF6 /CF4 mixture solid lines and a pure CF4 dashed lines or b pure SF6 dotted lines vs the electron energy under the same E / N values as given in Table IV. ...

Еще в разделе: (Показать все результаты (>17) - beams.chem.msu.ru/ )

... Robert Hermann Brookline, MA (Received November 22, 1999) der to illustrate the obvious progress, one can mention a variety of examples. ... In or- FYI Item "BMS Report on Institutes" As a member of the panel commissioned by the Board on Mathematical Sciences of the National Research Council, I write to correct several inaccuracies in the "For your information" note by Allyn Jackson entitled "BMS Report on Institutes" in the December 1999 issue of the Notices. ...

Еще в разделе: (Показать все результаты (>58) - chaos.phys.msu.ru/ )

Brain Research Group >> Research >> Change-point analysis ... << previous next >> . ... When detection of the change-points in alpha band power was performed as in the previous subsection, more than one change-point per second was obtained in average. ... The hypothesis of the hierarchy of EEG segmental descriptions (Kaplan 1998) (see subsection 7.3.2) is a theoretical reason for introducing the adjustment of the change-point detection probability. ...

Еще в разделе: (Показать все результаты (>50) - brain.bio.msu.ru/ )

• Change-points in multi-channel EEG
• Change-points in EEG components with different pattern
• Other prospects of the change-point based analysis