. NUCLEON Experiment . General information . Instrument . Participants . Goal of experiment . Experiment NUCLEON aimed to direct measurements of the elemental energy spectra of high-energy (10 12 -10 15 eV) cosmic rays (CR) during 5 years (2010-2014) abroad Russian regular satellite. The main goal of this project -- to clarify the Cosmic Rays origin. Now it is expected that CR are accelerated in most catastrophic processes in the Galaxy and may be in Universe

Еще в разделе: (Показать все результаты (>11) - smdc.sinp.msu.ru/ )

• Spatial distributions of particles (based on data from Coronas-F and

. Русский . English .

Еще в разделе: (Показать все результаты (>2) - termogaz.imec.msu.ru/ )

• left_frame_e

Russian . Selected publications of V. Zakharov 2015 . Zakharov V.S., Perchuk A.L., Zavyalov S.P., Sineva T.A., Gerya T.V. Supercomputer Simulation of Continental Collisions in Precambrian: The Effect of Lithosphere Thickness // Moscow University Geology Bulletin. ... P. 77–83. doi: 10.3103/S014587521502012X. Paper (pdf) . ... Paper (pdf) . ... Summary in English . ... DOI: 10.3103/S014587521101011X. Paper (pdf) . ... Paper (pdf) Summary in English . ... Page design: ©V.Zakharov . ...

Еще в разделе: (Показать все результаты (>17) - dynamo.geol.msu.ru/ )

• V.Zakharov

. Bulk of the information is in the Russian version . Go there if you can read Russian . General Information . Personalia . Science and Publications . Uralian Expedition . Crimean Student Practice . Uralian Student Practice . Software , Miscelaneous Informationx . Photoalbums . Address any question to and@geol.msu.ru

Еще в разделе: (Показать все результаты (>12) - sbmg.geol.msu.ru/ )

• publ-KIA
• ПубликацииТАВ

... Azizov . ... Chemical Enzymology Department, Chemical Faculty . ... April 7 1980, Baku, Azerbaijan . ... Master's Degree, The M.V. Lomonosov Moscow State University, Chemical Faculty, Chemical Enzymology Department, 1998 - 2003 . Baku Private Turkish College, School Diploma (Gold Medal), Baku, Azerbaijan, 1994 - 1998 . ... 1997 - golden medal in Republican Chemistry Olympiads (Azerbaijan) . 1998 - golden medal in Republican Chemistry Olympiads (Azerbaijan) . ...

Еще в разделе: (Показать все результаты (>104) - www.enzyme.chem.msu.ru/ )

• Senko O.V.
• Efremenko E.N.
• Gudkov D.A.

... Department of Mathematics, . Faculty of Physics, MSU . ... Differential equations . ... Mathematical analysis 2 . Numerical Methods (A.N. Bogolyubov) . Numerical methods in physics . ... Abstract differential equations with applications in mathematical physics . ... Asymptotic methods in nonlinear problems of mathematical physics . ... Methods of finite differences in mathematical physics . ... April 13, 2016. ... Department of Mathematics, Faculty of Physics, Lomonosov MSU 2014-2016 ...

Еще в разделе: (Показать все результаты (>5) - math.phys.msu.ru/ )

VENUE IMPORTANT DATES Paper Submission Deadline Notification of Acceptance Beginning of Early-Bird Registration February 17, 2012 April 13, 2012 April 13, 2012 April 30, 2012 Early Bird Registration Deadline Registration Deadline for Inclusion in the Program Announcement of the Final Conference Program Conference Dates May 25, 2012 June 8, 2012 July 1-6, 2012 The Roles of Context, Culture and Representations in Physics Teaching & Learning It is the only city which bridges two geographic continents.. ...

Еще в разделе: (Показать все результаты (>16) - foroff.phys.msu.ru/ )

• http://foroff.phys.msu.ru/eng/docs/En_cont_last1.doc

. Analytical chemistry departmemt . Electrochemistry methods laboratory . MAIN PAGE | MEMBERS_ | SCIENCE | EDUCATION | CONTACT INFORMATION | _WEB-SITE OF THE DEPARTMENT_ . Research topics . Publications . Funded projects . Partners . Joint laboratory MSU-LG Electronics . Scientific publications of laboratory members you can find on personal pages in the section "Members" . 2015, Laboratory of Electrochemical Methods

Еще в разделе: (Показать все результаты (>38) - analyt.chem.msu.ru/ )

• Laboratory of Electrochemical Methods
• Moscow State University: Analytical Chemistry Division

... Fiber optic hidrophones . ... A fiber optic air backed mandrel hydrophone to detect high energy hadronic showers in the water". ( text ) . ... The realization of an optic fiber air backed mandrel hydrophone for frequencies up to 20 kHz". ( text ) . M. Anghinolfi, A. Bersani, A. Calvi, A. Cotrufo, M. Ivaldi, O. Ershova, F. Parodi, D. Piombo, A. Plotnikov and L. Repetto "Measurement of the frequency responsivity of a fiber optic air backed mandrel hydrophone up to 10 kHz in air". ( text ) . ...

Еще в разделе: (Показать все результаты (>14) - antares.sinp.msu.ru/ )

• ANTARES in MSU

... THEORETICAL BASES AND EXPERIMENTAL ANALYSIS OF SOIL SOLUTION TRANSFORMATION UNDER INDUSTRIAL POLLUTION AND REHABILITATION OF SOILS . ... Transformation of soils solutions under air pollution impact. ... Prediction of soil solution changes in response to soil contamination and rehabilitation with dynamic bigeochemical models. The project aims to study, both theoretically and experimentally, response of soil solutions to contamination/remediation of soils by/from heavy metals. ...

Еще в разделе: (Показать все результаты (>10) - eco.soil.msu.ru/ )

• Polluting metals in Russian terrestrial ecosystems: chemistry, dynamics, and
• Norwegian-Russian cooperation in the border area
• Risks of heavy metal inputs to agricultural and forest ecosystems in russia and

.

Еще в разделе: (Показать все результаты (>3) - lab110.imec.msu.ru/ )

... I.A. Kurova . ... The research is mainly devoted to the problems of generation, recombination and trapping of nonequilibrium carriers in amorphous hydrogenated semiconductors (a-Si:H, a-Ge:H, a-SiGe:H) and generation and relaxation of metastable states in these materials. ... Light-induced metastable states in undoped, doped and compensated a-Si:H films were studied in a wide temperature range. ... Effect of annealing on the photoelectric properties of boron-doped a-Si:H films. ...

Еще в разделе: (Показать все результаты (>30) - scon155.phys.msu.su/ )

• Andrei G. Kazanskii
• Ida A. Kurova
• Nataliya N. Ormont

THE LABORATORY OF CHEMISTRY AND PHYSICS OF SENSOR AND SEMICONDUCTOR MATERIALS . ... Group research focuses on chemistry, physics and materials science of colloidal semiconductor nanocrystals ( colloidal quantum dots ). Colloidal quantum dots from the chemical viewpoint are semiconductor nanocrystals stabilized by amphiphilic molecules. ... colloidal quantum dots as photosensitizers in solar cells . ... 2008-2010 The Laboratory of chemistry and physics of sensor and semiconductor materials. ...

Еще в разделе: (Показать все результаты (>33) - www.lssm.inorg.chem.msu.ru/ )

• Лаборатория химии и физики полупроводниковых и сенсорных материалов | Дирин

Triple I – Integration, Interaction and Institutions Call for Applications Application deadline 22 April 2009 for mobilities starting during spring 2010 at the latest. Triple I awards scholarships for studies and research in 19 European and Russian partner universities. ... Triple I awards scholarships within the theme of Integration, Interaction and Institutions. ... All applications are expected by 22 April 2009, 14:00 Finnish time (GMT +2) at the latest. ...

Еще в разделе: (Показать все результаты (>29) - www.mgubs.ru/ )

• http://www.mgubs.ru/images/Image/Aleksanteri_Institute_Visiting_Fellowships_cfp_2013-2014.pdf
• http://www.mgubs.ru/images/Image/Aleksanteri_Visiting_Fellowships_2011-2012.pdf

... MCCME, Moscow 3 papers and (a) English edition of the textbook "Probability", vol. ... Springer, Berlin, 2006. ... 4 C. Conferences (as a participant): · Plenary talk at the Conference on Probability Theory and Mathematical Statistics dedicated to the centenary of A. N. Kolmogorov (September 21­27, 2003, Tbilisi, Georgia); · Plenary talk at the Franco- Russian Colloquium Perspectives de coopґ ation en informatiques et mathґ er ematiques appliquґ ees (October 2003, Moscow ); · Plenary ...

Еще в разделе: (Показать все результаты (>46) - new.math.msu.su/ )

• Научный портал механико-математического факультета МГУ
• Вестник МГУ. Математика. Механика
• I заочная олимпиада по "экстремальным задачам" | Department: General Problems

... References . ... References to books should include the author's name; year of publication; title; page numbers where appropriate; publisher; place of publication, in the order given in the example below. ... Ramirez, F. J., Marquez, R. A. C., and Mondaca, G.: 1991, The 1877 great tsunami and the rapid local warning network in the coast of Northern Chile - South America, In: Proc. International Conference of Australian Earthquake Engineering Society , Brisbane, Australia, 25-1. ... Information . ...

Еще в разделе: (Показать все результаты (>14) - seac47-2.phys.msu.ru/ )

... 1998 1 : Defended the Doctorate Degree Thesis on "Models of Cosmic Ray Particle Fluxes (Development and Applications)". ... Space Weather . ... Nymmik R.A., Radiation Environment Induced by Cosmic Ray Particle Fluxes in International Space Station Orbit According to Recent Solar and Galactic Cosmic Ray Models, Adv. ... Nymmik R.A., Radiation Environment Induced by Cosmic Ray Particle Fluxes in International Space Station Orbit According to Recent Solar and Galactic Cosmic Ray Models, Adv.Space Res. ...

Еще в разделе: (Показать все результаты (>7) - srd.sinp.msu.ru/ )

Tsunami source parameters versus earthquake magnitude and depth: Monte Carlo simulation Mikhail Nosov and Anna Bolshakova M.V.Lomonosov Moscow State University, Faculty of Physics, Moscow, Russian Federation (m.a.nosov@mail.ru) European Geosciences Union General Assembly 2011 Vienna | ... Among all possible parameters of a tsunami source we consider only those parameters which can be unambiguously calculated from the vertical component of co-seismic bottom deformations. ...

Еще в разделе: (Показать все результаты (>17) - ocean.phys.msu.ru/ )

• http://ocean.phys.msu.ru/courses/geo/lectures-addons/02/2009%20Bromm%20et%20al.%2C%20The%20formation%20of%20the%20first%20stars%20and%20galaxies.pdf

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>87) - www.genebee.msu.ru/ )

• Лаборатория регуляции белкового синтеза
• Laboratory of protein synthesis regulation
• AliGraf - GeneBee Graphical Alignment Help

34th Meeting of the German Association for Acoustics (DAGA 2008) March 10 - 13, 2008, Dresden, Germany Deadline for abstract submission: November 1, 2008 . 11th European Mechanics of Materials Conference (MECAMAT) "Mechanics of microstructured solids: cellular materials, fibre reinforced solids and soft tissues" March 10 - 14, 2008, Turin, Italy Deadline for abstract submission: November 15, 2007 . ... 20th International Congress on Acoustics (ICA2010) August 23 - 27, 2010, Sydney, Australia . ...

Еще в разделе: (Показать все результаты (>24) - acoustics.phys.msu.ru/ )