... Algorithm & . Format requirements . ... SDPsite is a tool for identification of protein active and other functional sites, based on spatial clustering of SDPs (specificity-determining positions, described here ) with CPs (conserved positions). ... Mapping predictied positions onto structure and construction of the best cluster . ... The input data of the algorithm are a multiple protein alignment divided into specificity groups . ... is called statistical significance of the set of k* positions . ...

Еще в разделе: (Показать все результаты (>138) - bioinf.fbb.msu.ru/ )

• RNA kinetics server
• SDPpred
• SDPsite - Gallery of examples

... It is shown that theoretical methods developed for description of hopping transport in disordered inorganic solids, such as amorphous semiconductors, can also be successfully applied to description of hopping transport in organic disordered systems, such as conjugated or molecularly doped polymers. We concentrate our discussion on percolation approach and show its universal applicability to systems with different distributions of localized state energies. ...

Еще в разделе: (Показать все результаты (>72) - scon155.phys.msu.su/ )

• Generalized pair approximation in the description of ate AC conductivity of a
• Ferroelectric phase transitions in IV-VI semiconductors associated with

... Программа на сентябрь 2008 г. 24 сентября. H. Wakaki (Hiroshima University). An error bound for Box's chi-square type asymptotic expansion of Wilks' Lambda distribution. Abstract. An error bound for the Box's chi-square type asymptotic expansion of Wilks' Lambda distribution is derived. It is compared with an error bound for the high-dimensional Edgeworth expansion. ... Convergence of Multinomial Goodness-of-fit Statistics to Chi-square Distribution. ...

Еще в разделе: (Показать все результаты (>54) - new.math.msu.su/ )

• http://new.math.msu.su/department/probab/spec/Materialy_po_kursam_Tutubalina/Finstat/Bashelie/Bachelier100years.pdf
• http://new.math.msu.su/department/probab/bsk10_14.htm
• http://new.math.msu.su/Sites/demosite/Uploads/abstractsm50.58D32DCEDD634CB0AA8244EDE617F1DB.pdf

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>10) - storage.bioinf.fbb.msu.ru/ )

. Система визуализации и анализа результатов Fatal error: Class 'PDO' not found in /extend/polygon/visualization.php on line 368

Еще в разделе: (Показать все результаты (>2) - www.polygon.parallel.ru/ )

... A new data acquisition system was implemented to allow us to handle the high data rates produced by the multiple triggers. ... The LGD system includes the 9 ton glass array of 4 cm x 4 cm x 45 cm blocks, a transporter capable of placing each module in an electron beam for calibration and a monitoring system. ... A unique feature of E852 is the ability to make a trigger decision based on either the total energy or the effective mass of a system of photons. ... First, the energy cluster must be narrow...

Еще в разделе: (Показать все результаты (>44) - lav01.sinp.msu.ru/ )

• http://lav01.sinp.msu.ru/~vlk/3pi0.ps
• http://lav01.sinp.msu.ru/nir/papers/PRD72001.pdf
• http://lav01.sinp.msu.ru/nir/papers/IEEE_TNS_52_3_2005_741-744.pdf

... 2 Ї ґ , , Ї ґ Ї ґ , 03.12.2015 . ... 14 03.12.2015 Ї Ї Ї 03.12.2015 . ... Verifier Uni ve rsi ty of Te x as 2013 Anteater Uni ve rsi ty of Il l i noi s 2011 FlowChecker Uni ve rsi ty of North Carol i na 2010 VERMONT Network disjoint Port #02 Port #03 h2 h3 s1 Port #01 h1 Port #04 h4 main: disjoint() := Forall[x, out_x, y, out_y: !R(x, out_x) or !R(y, out_y) or x[p] == out_y[p] and out_x[p] == y[p] or x VERMONT proxy CLI Packets are delivered through the control plane We can block them! ...

Еще в разделе: (Показать все результаты (>8) - lvk.cs.msu.su/ )

• http://lvk.cs.msu.su/~bahmurov/course_advanced_networks/ITU_OTN_Tutorial.pdf

... The applied mathematics (with Honors), Kazan State University, Kazan, Russia (USSR), 1980. nd Alexander Lazarev Research Interests Discrete optimization: combinatory problems, modeling, decomposition algorithms, applications to production planning and scheduling. ... Kazan, Publishing house of the Kazan mathematical society, 1998. - 285 p. Lazarev A.A., Gafarov E.R. Scheduling Theory. ... Computer centre of the Russian Academy of Sciences - 2006. - 134 p. Lazarev A.A., Gafarov E.R. Scheduling Theory...

Еще в разделе: (Показать все результаты (>4) - physcontrol.phys.msu.ru/ )

... An Analysis of Modern Discrete Movements of the Earth's Crustal Blocks in Geodynamically Active Regions Based on GPS Data V. S. Zakharov and D. A. Simonov Moscow State University, Moscow, 119991 Russia e mail: zakharov@dynamo.geol.msu.ru; simon@geol.msu.ru Received March 24, 2009 Abstract--In this work original algorithms are proposed that allow us to provide a set of points (clusters) on a surface that are in cooperative motion, on the basis of an analysis of GPS data. ... Method O1. ...

Еще в разделе: (Показать все результаты (>23) - dynamo.geol.msu.ru/ )

• http://dynamo.geol.msu.ru/personal/vsz/papers/Zakharov_2011_2_eng.pdf
• Summaries of articles

. NON-STATIONARY OPERATION OF THE FAST-FLOW LASERS . AND NEW POSSIBILITIES OF CONTROLLING THE LASER OUTPUT CHARACTERISTICS . A.V. Mushenkov, A.Yu.Loskutov, A.I.Odintsov, A.I.Fedoseev and V.F.Sharkov . Physics department of M.V.Lomonosov Moscow State University, 119899, Vorob'evy gory, Moscow, Russia . Abstract . The dynamics of the lasing of the fast crossflow gas laser with the inhomogeneous steady state pumping in the unstable resonator by means of numerical modeling is investigated. Depending on the

Еще в разделе: (Показать все результаты (>14) - optics.sinp.msu.ru/ )

• Our publications
• Иллюстрации 1 и 2
• Иллюстрации 3 и 4

html head title Перемещение слоя в режиме drag /title script language= javaScript !-- var app; var szx = 0 ; var szy = 0 ; function start_drag () { app = document.applets.red; app.open_change_mode(0); rc = app.set_current_layer(' show '); if( rc==-1 ) {alert( Нет указанного слоя show ); return ;} app.set_ drag _layer( show ); drag (); ...

Еще в разделе: (Показать все результаты (>25) - adept.srcc.msu.ru/ )

• http://adept.srcc.msu.ru/adept/java/applet_book/ch_box/ch2text1.htm
• http://adept.srcc.msu.ru/adept/java/applet_book/drag/drag2text1.htm
• http://adept.srcc.msu.ru/adept/java/applet_book/ch_box/ch1text1.htm

. Name . Last modified . Size . Description . about_center/ . 14-Sep-2013 14:31 . - . sections/ . 31-Oct-2007 14:46 . - . Apache/2.2.16 (Debian) Server at educenter.sinp.msu.ru Port 80

Еще в разделе: (Показать все результаты (>9) - educenter.sinp.msu.ru/ )

... There are two main thrusts in the theory of regular and chiral p olytop es: the abstract, purely combinatorial asp ect, and the geometric one of realizations. ... The dimension of a faithful realization of a finite abstract regular p olytop e in some euclidean space is no smaller than its rank, while that of a chiral p olytop e must strictly exceed the rank. ... In E4 , therefore, the open cases are the (finite) chiral polytopes of rank 3, and the regular or chiral apeirotopes of ranks 3 and 4. ...

Еще в разделе: (Показать все результаты (>36) - dfgm.math.msu.su/ )

• http://dfgm.math.msu.su/files/golo/modelling.pdf
• http://dfgm.math.msu.su/files/ivanov-tuzhilin/Lecture_Notes.pdf
• http://dfgm.math.msu.su/files/0articles/Ilyutko/ilyutko-JKTR.pdf

... 07.04.2016 (Thursday) Session 1 10:00-10:20 10:20-10:40 10:40-11:00 11:00-11:20 11:20-11:40 ґ ґ ґ ґ ґ (chairman ґ M. Stynes) N. Kopteva V. Andreev H.-G. Roos S. Franz, H.-G. Roos A posteriori error estimates for singularly perturbed reactiondiffusion problems on anisotropic meshes. ... Numerical solution of a singularly perturbed initial-boundary value problem with a Neumann condition for a parabolic equation. ... Boundary layer solutions to time-periodic singularly perturbed parabolic problems. ...

Еще в разделе: (Показать все результаты (>2) - math.phys.msu.ru/ )

... At present, SDSS (ugriz), UKIRT WFCAM (YJHK), ; Johnson-Cousins (UBVRcIc), and 2MASS (J2H2Ks2) ; are supported ; redshift - redfshift of a galaxy ( floating point) ; colour_name - colour identification (string) ; colour_value - value of colour in magnitudes ( floating point) ; should be in the AB mags for ugrizYJHK ; and in Vega mags for Johnson-Cousins/2MASS colours ; ; RETURN VALUE: K-correction in the specified filter for given redshift ; and ...

Еще в разделе: (Показать все результаты (>10) - kcor.sai.msu.ru/ )

• http://kcor.sai.msu.ru/calc_kcor.pro
• K-corrections calculator (version 2010): download IDL, Python and C code
• K-corrections calculator: download IDL, Python and C code

... 1 : -1); } function global_depth($f) { $flds = _read('folders.dat'); if ($f == '') return 0; $j = $f; $d = 0; while ($flds[$j]['parent'] != '') { $j = $flds[$j]['parent']; $d++; } return $d + 1; } function fext($url) { return strtolower(substr($url, strrpos($url, '.')+1)); } function global_drawfile($id) // { global $lang; $dscs = _read('files.dat'); // global $lang; if (isset($dscs[$id])) { $s = ' . ... lang=='en'?date('Y/m/d h:i A', $dscs[$id]['time']):date('d.m.Y H:i', $dscs[$id]['time'])).' ...

177. Abstract

178. http://cellmotility.genebee.msu.ru/html/articles/jcs.pdf

179. http://www.parallel.ru/sites/default/files/ftp/cluster/intel-8.0/for_qopl.pdf

180. http://ics.org.ru/upload/iblock/650/122-kinetics-of-collisionless-continuous-medium_ru.pdf