... Multi-threaded search engines . ... Unfortunately, most documents on search engines I saw in the Internet were either lists of hyperlinks without any comments, or discussions about how many documents are in the database of ... (here is the name of a search engine) and what method of counting of the number of documents was used. No words about the efficiency, i.e. how many documents on some subject I can find using this search engine, especially in comparison with the other ones. ...

Еще в разделе: (Показать все результаты (>3) - scon155.phys.msu.ru/ )

• XAFS Publication Database search form

... You have to choose only one answer among the suggested options; for tasks 1-4 write down `agree' beside the answer you choose. ... Peptide bond between amino acids in a molecule of protein is underlaid by: a) b) c) d) the principle of complementarity; insolubility of amino ac ids in water; solubility of amino acids in water; the presence of carboxy and amino group; Task 2. ... There are ten cards, each with one side white and one side black. ... What is your understanding of the word "progress"? ...

Еще в разделе: (Показать все результаты (>139) - www.psy.msu.ru/ )

• http://www.psy.msu.ru/science/psyrussia/2013-3/2013_3_107-119.pdf
• http://www.psy.msu.ru/science/psyrussia/2009/podolskij.pdf
• http://www.psy.msu.ru/science/psyrussia/2013-2/bazarov_2013_2.pdf

... ADSP2181 Data Sheet. ... ********************* ********* * * This sample program is organized into the following sections: * * Assemble time constants * Interrupt vector table * ADSP 2181 intialization * ADSP 1847 Codec intialization * Interrupt service routines ********************************************************* ********* .module/RAM/ABS=0 loopback; {************* ... transmit i? 68 |||! |||! |||+============= control bit ||+-------------|+--------------control bit +---------------- ! ...

Еще в разделе: (Показать все результаты (>2) - lib.sinp.msu.ru/ )

Academic English English for Students of Mathematics and Mechanics Supplementary Exercises Part I L.N.Vygonskaya O.Y.Sviridenko MSU Moscow 2012 Academic English (part 1 of 4) Unit 1 Task 7 Fill in the missing letters in the words which denote various branches of mathematics. m_t_m_th_m_t_cs _lg_br_ c_lc_l_s st_t_st_cs _r_thm_t_c g_ _m_tr_ Now read the first part of the text (pp. 19-21) and put the branches in the same order as they are mentioned in the text. ... What is a topic sentence? ...

Еще в разделе: (Показать все результаты (>18) - www.eng.math.msu.su/ )

• http://www.eng.math.msu.su/download/Margaret_Thatcher_article_and_vocabulary.pdf
• http://www.eng.math.msu.su/download/plan.pdf
• http://www.eng.math.msu.su/download/Academic_English_part2.pdf

... Specialist degree . ... Master degree . ... Master variants . ... About Faculty . ... Mechmath faculty admission resumed its work and is actively preparing for the new reception 2015! ... Read more about Schedule in June . ... The Dean of Mechanics and Mathematics Faculty, the head of the Department of Mathematical and Computer Analysis Methods, professor Vladimir Chubarikov ; . ... Read more about The Open Day . ... 2016 Mechmath admission for internetional students ...

Еще в разделе: (Показать все результаты (>4) - pk.math.msu.ru/ )

• information | Mechmath admission for internetional students

... Manuscripts submitted to the journal should be divided into the following sections: Title page, Abstract (in Russian and English), Key words (in Russian and English), main manuscript text, list of references, tables, figures and figure captions. ... Full size of the article includes list of references, tables and figures. ... Rich text format (*.rtf) . ... References are given in the text in square brackets; full references are given at the end of the manuscript in the section List of references. ...

Еще в разделе: (Показать все результаты (>22) - www.anthropos.msu.ru/ )

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>8) - storage.bioinf.fbb.msu.ru/ )

Sergey A. Ayvazyan Methods of Econometrics Introduction Dear reader, You have a textbook in your hands on methods of econometrics, one of the three basic disciplines of higher economic learning, along with micro- and macroeconomics. In Russia, unfortunately, the status of econometrics was recognized belatedly: econometrics was introduced into the study programs of economic learning in several leading Russian higher educational institutions only since 1992. ...

Еще в разделе: (Показать все результаты (>13) - www.mse-msu.ru/ )

... О факультете . ... Master In Ecology . ... Master (MSc) . ... A Master will be able to successfully deal with conceptual issues and practical problems related to various subflields of ecology and environmental science. ... Enables the students to develop biopolicies to deal with ecological problems caused by environmental pollution, the disruption of the ecological matrix of an area, and biodiversity-endangering factors. ... Lectures . ... Д 501.001.20 - все защиты . ... Биологический факультет МГУ ...

Еще в разделе: (Показать все результаты (>4) - www.bio.msu.ru/ )

• Master In Nanobiotechnology ? Биологический факультет МГУ

... A p P EC Astropar ticle Physics for Europe · Cosmic rays: A large array for the detection of charged cosmic rays ( Auger North) · Gamma rays: A large array of Cherenkov Telescopes for detection of cosmic high energy gamma-rays ( CTA ) · High energy neutrinos: A cubic kilometre-scale neutrino telescope in the Mediterranean (KM3NeT) · Dark matter search: Ton-scale detectors ... A p P EC Astropar ticle Physics for Europe · Cosmic rays: ­ ­ ­ ­ ­ AMS detector launched. ...

Еще в разделе: (Показать все результаты (>2) - tunka.sinp.msu.ru/ )

• http://tunka.sinp.msu.ru/en/presentation/Khrenov.pdf

... Electronic journal Issue 4. 10 september 2004 Ulrich M. Sustainable Management of Natural Resources Introduction. ... To learn about the dynamics of natural resource management and the tragedy of the commons by means of a direct experience in the simulation game «NEW COMMONS GAME». ... 2) Tragedy of the commons and management of natural resources. ... The simulation game was followed by a short debriefing on the dynamics of the tragedy of the commons and natural resource management. ...

Еще в разделе: (Показать все результаты (>8) - e-journal.spa.msu.ru/ )

• http://e-journal.spa.msu.ru/uploads/vestnik/2004/vipusk_4._sentjabr_2004_g./briedis.pdf

... Here is a brief outline of the current theory of the events in the early history of the solar system: . A cloud of interstellar gas and/or dust (the "solar nebula") is disturbed and collapses under its own gravity. ... The gas cools off enough for the metal, rock and (far enough from the forming star) ice to condense out into tiny particles. (i.e. some of the gas turns back into dust). ... Once the larger of these particles get big enough to have a nontrivial gravity, their growth accelerates. ...

178. Statistics One, Lecture 3, example script

179. http://foroff.phys.msu.ru/illposed/programs/Listing_03.txt

180. Index of /spravka/measure/Manual