... Electronic journal Issue 4. 10 september 2004 Briedis V. Pareto Structures A great Italian economist Vilfredo Pareto (1848 ґ 1923) in his unique economics and sociology studies [1, 2] continuously emphasised the systematic approach, reviewing the society development problems. ... Formal model of Pareto Structure First of all, provide a formal mathematical model adequately featuring the Pareto Structure. ... Indeed, I was primarily interested in the classical (harmonic structure) model at s = 1. ...

Еще в разделе: (Показать все результаты (>9) - e-journal.spa.msu.ru/ )

• http://e-journal.spa.msu.ru/uploads/vestnik/2004/vipusk_4._sentjabr_2004_g./nekipelov.pdf
• http://e-journal.spa.msu.ru/uploads/vestnik/2004/vipusk_4._sentjabr_2004_g./leigh.pdf

Contents Curricula, and Programs. Mathematical Analysis. (The Program of Mathematical Physics Department).............................................. Algebra and Analytical Geometry.(The program of (General "Mathematics" Department)................................ Computer and Programming. (The program of Algorithmic Languages Department).................................... The practical work on Computers.( Department of Algorithmic. Languages)............................................... Discrete

Еще в разделе: (Показать все результаты (>7) - mph.cmc.msu.ru/ )

Network Working Group T. Berners-Lee Request for Comments: 1945 MIT/LCS Category: Informational R. Fielding UC Irvine H. Frystyk MIT/LCS May 1996 Hypertext Transfer Protocol -- HTTP/1.0 Status of This Memo This memo provides information for the Internet community. This memo does not specify an Internet standard of any kind. Distribution of this memo is unlimited. IESG Note: The IESG has concerns about this protocol, and expects this document to be replaced relatively soon by a standards track document.

Еще в разделе: (Показать все результаты (>4) - hea-www.harvard.edu/ )

• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/rfc2396.txt
• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/rfc1808.txt
• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/rfc2068.txt

LOCAL TSUNAMI WARNING AND MITIGATION ________________________________________________________________________________________________________________________________________ THE NEW GRIDDED KURIL-KAMCHATKA BATHYMETRY FOR TSUNAMI MODELING An. ... For calculations in each grid point where the depth is to be found the algorithm uses up to 9 points from data source. ... Then the spline interpolation is used for defining the depth value in the grid-point. ... Hydrographic Survey Data, CD-ROM data set, Ver. ...

Еще в разделе: (Показать все результаты (>22) - seac47-2.phys.msu.ru/ )

• LOCAL TSUNAMI WARNING AND MITIGATION -- Proceedings Download Page

... Vol, 45. ... CELL BIOPHYSICS Levels of Regulation of Photosynthetic Processes G. Yo. ... These mechanisms provide strict light-dependent regulation of electron transport in photosynthetic reaction centers and more flexible regulation at the level of interaction between pboeosystems, transmembrane fluxes of ions, and coupling with dark reactions of the Calvin cycle. A generalized mathematical model was constructed. ... LEVELS OF REGULATION OF PHOTOSYNTHETIC PROCESSES 441 systems of regulation. ...

Еще в разделе: (Показать все результаты (>34) - library.biophys.msu.ru/ )

• http://library.biophys.msu.ru/PDF/3340.pdf
• http://library.biophys.msu.ru/PDF/3336.pdf
• http://library.biophys.msu.ru/PDF/3345.pdf

... Gasґliquid exchanges (i.e. gas transfer: rapid-medium). ... Ni pgas pH pKa q Si SI t T V Xi Ysubstrate i,j fproduct,substrate i carbon content of component i component index (see appendix) inhibition function (various, see Table A2) process index (see appendix) acid-base rate constant for component i first order decay rate for biomass death gas ґ liquid transfer coefficient specific Monod maximum uptake rate acid-base equilibrium constant Henry's law coefficient ...

Еще в разделе: (Показать все результаты (>88) - www.enzyme.chem.msu.ru/ )

• http://www.enzyme.chem.msu.ru/ekbio/article/UASB2006.pdf
• Group of microbial biochemistry and biotechnology
• Vyacheslav V

A GENETIC ALGORHYTM FOR OPTIMIZING A NEURAL NETWORK CAPABLE TO LEARN FOR FOOD SEARCHING IN A RADIAL MAZE Budilova E.V., Chepurnova N.E., Chepurnov S.A, Teriokhin A.T. M.V.Lomonosov Moscow State University, Dept. of Biology. ... The upper platform has a hole in the middle and several radially directed tubular canals ("arms") each of which can contain a peace of food and has doors opening only in the centrifugal direction. ... The task of the animal is to visit only those arms which contain food. ...

Еще в разделе: (Показать все результаты (>27) - ecology.genebee.msu.ru/ )

• http://ecology.genebee.msu.ru/3_SOTR/CV_Terekhin_publ/2004_Birthweight_JEvolBio.pdf
• http://ecology.genebee.msu.ru/3_SOTR/CV_Terekhin_publ/2003_Envir_human_EER.pdf
• http://ecology.genebee.msu.ru/3_SOTR/CV_Terekhin_publ/2000_Longev_JEvolBio.pdf

European Research Council Guidance Notes for preparing the Grant Agreement ERC Grant Schemes (Starting Grant ґ Advanced Grant) 24 July 2008 The Guide is published by the ERC on http://erc.europa.eu It can also be downloaded from the CORDIS page on http://cordis.europa.eu ) This guidance1 is provided for information purposes and easing cooperation. These notes do not replace legal sources but aim at assisting participants who are invited for preparation of the Grant Agreement following the evaluation of

Еще в разделе: (Показать все результаты (>32) - ideas.msu.ru/ )

• http://ideas.msu.ru/docs/CSA_guide_2008.pdf
• http://ideas.msu.ru/docs/fp7_rules.pdf
• http://ideas.msu.ru/docs/call_StG_2012.pdf

... Consider a matrix S. The element sij of S is equal to the number of inextendible directed sequences from the minimal vertex i to the maximal vertex j . ... Therefore the number of directed sequences from the vertex i to the vertex j is equal to the element wij of a matrix W: N W= k =0 V k , (1 9 ) 6 where N is equal to the number of edges in the graph. ... Tr S is equal to the number of inextendible directed sequences from minimal vertexes to maximal vertexes that have equal numbers. ...

Еще в разделе: (Показать все результаты (>14) - temporology.bio.msu.ru/ )

• http://temporology.bio.msu.ru/EREPORTS/krugly_unfaithful.pdf
• http://temporology.bio.msu.ru/EREPORTS/krugly_discreet-mechanics.pdf
• http://temporology.bio.msu.ru/EREPORTS/krugly_discrete.pdf

... Полная версия этой страницы: Каррент мьюзик . Студенческий форум Физфака МГУ > Общий > ТРЕП > Карренты . ... True andЪ EvilЪ . ... Posted by 195.91.219.66. of WebWarper: see /han Example of using WebWarper: http://www.webwarper.net/ww/~av/forum.dubi...hp?showforum=42 ] . ... 11.12.2005, 12:31 . ... Posted by 195.91.219.66. of WebWarper: see /han Example of using WebWarper: http://www.webwarper.net/ww/~av/forum.dubi...dex.php?act=idx ] . ...

Еще в разделе: (Показать все результаты (>974) - wasp.phys.msu.ru/ )

• Студенческий форум Физфака МГУ > PhD positions in Switzerland
• Студенческий форум Физфака МГУ > Программирование
• Студенческий форум Физфака МГУ > Предствление Гейзенберга в случае

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>11) - storage.bioinf.fbb.msu.ru/ )

• http://storage.bioinf.fbb.msu.ru/~roman/bmc_genom2_2013.pdf

... In a sphere-plane geometry, routinely used in atomic force microscope and surface force apparatus, it can form a bridge connecting the surfaces. ... By minimizing the free energy of a binary mixture we obtain the force-distance curves as well as the structural phase diagram of the configuration with the bridge. Numerical results predict a discontinuous transition between the states with and without the bridge and linear force-distance curves with hysteresis. ... Phys., Vol. ...

Еще в разделе: (Показать все результаты (>31) - nanofluidics.phys.msu.ru/ )

• http://nanofluidics.phys.msu.ru/paper/prl2010_2.pdf
• http://nanofluidics.phys.msu.ru/paper/JCP2014-2.pdf
• http://nanofluidics.phys.msu.ru/paper/JCP2013.pdf

... 2 Ї ґ , , Ї ґ Ї ґ , 03.12.2015 . ... 14 03.12.2015 Ї Ї Ї 03.12.2015 . ... Verifier Uni ve rsi ty of Te x as 2013 Anteater Uni ve rsi ty of Il l i noi s 2011 FlowChecker Uni ve rsi ty of North Carol i na 2010 VERMONT Network disjoint Port #02 Port #03 h2 h3 s1 Port #01 h1 Port #04 h4 main: disjoint() := Forall[x, out_x, y, out_y: !R(x, out_x) or !R(y, out_y) or x[p] == out_y[p] and out_x[p] == y[p] or x VERMONT proxy CLI Packets are delivered through the control plane We can block them! ...

Еще в разделе: (Показать все результаты (>8) - lvk.cs.msu.su/ )

... R.S. Swift and K.M. Spark (Eds) ? 2001 IHSS Two dimensional NMR spectroscopy of humic substances N. Hertkorn1, Ph. ... Analogous procedures have been applied to 15N and 31P NMR spectroscopy of humic substances. ... The quantitative information obtained from cross peak integrals in 2D NMR spectra is strongly affected by the time dependence of the transfer amplitude of the respective experiment and by the relaxation characteristics of the material. ... Protein NMR Spectroscopy, Principles and Practice...

Еще в разделе: (Показать все результаты (>110) - mgumus.chem.msu.ru/ )

• http://www.mgumus.chem.msu.ru/ihss/pdf/nl_37.pdf
• Instructions for book-contributors

ISSN 1464-8997 (on line) 1464-8989 (printed) 281 Geometry & Topology Monographs Volume 3: Invitation to higher local fields Part II, section 8, pages 281ґ292 8. Higher local skew fields Alexander Zheglov n -dimensional local skew fields are a natural generalization of n -dimensional local fields. ... For example, K is a (commutative) local field and the skew field represents elements of the Brauer group of the field K (see also an example below). ... Higher local skew fields 283 8.2. ... Proof. ...

Еще в разделе: (Показать все результаты (>38) - dfgm.math.msu.su/ )

• http://dfgm.math.msu.su/files/ivanov-tuzhilin/Lecture_Notes.pdf
• http://dfgm.math.msu.su/files/papers-sym/0503389v1.pdf
• http://dfgm.math.msu.su/files/papers-sym/reg%20maps%20nonorientable%20surfaces.pdf

... Natalia Kireeva graduated from the department of biochemistry and worked in different laboratories in Moscow and the USA. ... Maria Sudnitsyna graduated from Moscow State University in 2004, and during the next two years, she investigated the mechanisms of the function of mitochondrial Complex I. Then, she continued her work in a biotechnological firm, and in 2008, she returned to Moscow State University and started her work at the Department of Biochemistry in the group of Prof. N.B. Gusev. ...

Еще в разделе: (Показать все результаты (>27) - biochem.bio.msu.ru/ )

• Biochemistry Department of Moscow State University | Na,K-ATPase and its role

Magnetism Department MSU . ... Magnetism department . ... Magnetic Laboratory was created in Moscow State University by professor Vladimir Arkad ev. ... In 1918 Arkad ev returned in MSU where he founded Moscow Magnetic Laboratory, which exists for a long time on the enthusiasm of their members. ... As the head of new department professor Nikolay Akulov was assigned. ... During the period since 1954 till 1987 the head of magnetism division was Eugeny Kondorsky. ... Lomonosov MSU . ...

Еще в разделе: (Показать все результаты (>11) - magn.phys.msu.ru/ )

html head title Перемещение слоя в режиме drag /title script language= javaScript !-- var app; var szx = 0 ; var szy = 0 ; function start_drag () { app = document.applets.red; app.open_change_mode(0); rc = app.set_current_layer(' show '); if( rc==-1 ) {alert( Нет указанного слоя show ); return ;} app.set_ drag _layer( show ); drag (); ...

Еще в разделе: (Показать все результаты (>25) - adept.srcc.msu.ru/ )

• http://adept.srcc.msu.ru/adept/java/applet_book/ch_box/ch2text1.htm
• http://adept.srcc.msu.ru/adept/java/applet_book/drag/drag2text1.htm
• http://adept.srcc.msu.ru/adept/java/applet_book/ch_box/ch1text1.htm

... Interaction classes . ... List of Contact Types: . ... Contact with Major Groove of DNA by helices, loops and Minor Groove by any element(s) . ... Contact with Major Groove of DNA by strands, loops and Minor Groove by any element(s) . ... Contact with Major Groove of DNA by loops and Minor Groove by any element(s) . ... Contact with Major Groove of DNA by any element(s) and Minor Groove by helices, loops . ... Contact with Major Groove of DNA by any element(s) and Minor Groove by loops . ...

Еще в разделе: (Показать все результаты (>92) - npidb.belozersky.msu.ru/ )

• NPIDB: Home

. Name . Last modified . Size . Description . about_center/ . 14-Sep-2013 14:31 . - . sections/ . 31-Oct-2007 14:46 . - . Apache/2.2.16 (Debian) Server at educenter.sinp.msu.ru Port 80

Еще в разделе: (Показать все результаты (>9) - educenter.sinp.msu.ru/ )