Chemical Physics 409 (2012) 61-73 Contents lists available at SciVerse ScienceDirect Chemical Physics journal h omepage: www.elsevi er.c om/locate/chemphys Orientation distribution function and order parameters of oriented spin probe as determined by EPR spectroscopy Andrey Kh. ... 4о Fig. ... Orientation distribution functions obtained by simulation of spectra in Fig. 10: (a) using OP approach (parameters in column 1 of Table 6); (b) using OD approach (parameters in column 3 of Table 6). ...

Еще в разделе: (Показать все результаты (>139) - www.chem.msu.ru/ )

• Mathematical Chemistry
• Intuitive Chemical Topology Concepts
• Concept of Chemical Periodicity: from Mendeleev Table

... 001.89:004 .. , .. , .. , .. , .. , .., .. e-mail: kryukov@theory.sinp.msu.ru RESTFUL-- 2012-4/882 RESTful-- , : , , , UNIDATA Common Data Model, , , , , , . ... NCEP/NCAR [1], , ). , . ... RESTful-- , : , , , UNIDATA Common Data Model [2], , , , , , . ... UNIDATA Common Data Model (CDM) [2]. ... UNIDATA CDM 3. ... XML . ... Unidata Common Data Model. : http://www.unidata.ucar.edu/software/netcdf-java/CDM/ [3]. ... Network Common Data Form (NetCDF). : http://www.unidata.ucar.edu/software/netcdf/ [5]...

Еще в разделе: (Показать все результаты (>3) - sinp.msu.ru/ )

... Two-dimension linear regression model. ... The econometric modeling of time series . ... The course aims to provide students with basic models and methods of econometric modeling of financial time series. ... The course considers in detail the major methods of econometric modeling of time series, in particular modeling by stochastic processes, modeling of stationary and non-stationary time series, the spectrum analysis of time series. ... The problem of tax optimization under a given state budget. ...

Еще в разделе: (Показать все результаты (>11) - io.cmc.msu.ru/ )

elukashov@yandex.ru, evrad07@gmail.ru Received May 1, 2010; revised July 15, 2010; accepted July 17, 2010 Abstract Two mathematical crystallization models describing structure formations in instability zones are proposed and justified ... A crystallization model based on the phase field conception was constructed in [6], where, in particular, a sawtooth solution to the temperature distribution problem in the phase transition domain was obtained. ... We formulate conditions imposed on IAS-domains. ...

Еще в разделе: (Показать все результаты (>123) - mgumus.chem.msu.ru/ )

• http://www.mgumus.chem.msu.ru/publication/2001/hertkorn-two.pdf
• http://www.mgumus.chem.msu.ru/publication/2000/kudryavtsev-size-00.pdf
• http://www.mgumus.chem.msu.ru/publication/2008/2008-konstantinov-size.pdf

W. Hackbusch, B.N. Khoromskij, S. Sauter, and E. Tyrtyshnikov. Use of tensor formats in elliptic eigenvalue problems. Numerical Linear Algebra with Applications, 19(1):133-151, 2012. ... The results of numerical experiments clearly indicate the linear-logarithmic scaling of the low-rank tensor method in n. The algorithms work equally well for the computation of both minimal and maximal eigenvalues of the discrete elliptic operators . ...

Еще в разделе: (Показать все результаты (>72) - srcc.msu.ru/ )

• Kazakevich, Olga. Documentation and description of the Northern Selkup local
• Rafaeva, Anna. Description of Propp's Roles in Russian Magic Folktales
• Kazakevich, Olga. Endangered Languages Documentation and Description: Should

... Assume that gas is a thermodynamic system in the state of local equilibrium, that is, it is satisfied the relation [2] [pic] (1) There [pic],[pic] and [pic] are the temperature, the pressure and the gas volume, [pic], [pic] are entropy and internal energy per unit volume. ... Let us consider the first-degree form [pic]. ... Since the evolutionary relation is not identical, from this relation one cannot get the state differential [pic] that may point to the equilibrium state of the material system. ...

Еще в разделе: (Показать все результаты (>15) - hit-conf.imec.msu.ru/ )

• http://hit-conf.imec.msu.ru/books/NeZaTeGiUs_2010.pdf

... Полная версия этой страницы: Каррент мьюзик . Студенческий форум Физфака МГУ > Общий > ТРЕП > Карренты . ... True andЪ EvilЪ . ... Posted by 195.91.219.66. of WebWarper: see /han Example of using WebWarper: http://www.webwarper.net/ww/~av/forum.dubi...hp?showforum=42 ] . ... 11.12.2005, 12:31 . ... Posted by 195.91.219.66. of WebWarper: see /han Example of using WebWarper: http://www.webwarper.net/ww/~av/forum.dubi...dex.php?act=idx ] . ...

Еще в разделе: (Показать все результаты (>852) - wasp.phys.msu.ru/ )

• Студенческий форум Физфака МГУ > Предствление Гейзенберга в случае
• Студенческий форум Физфака МГУ > Программирование
• Студенческий форум Физфака МГУ > Пуазейль

European Research Council Guidance Notes for preparing the Grant Agreement ERC Grant Schemes (Starting Grant ґ Advanced Grant) 24 July 2008 The Guide is published by the ERC on http://erc.europa.eu It can also be downloaded from the CORDIS page on http://cordis.europa.eu ) This guidance1 is provided for information purposes and easing cooperation. These notes do not replace legal sources but aim at assisting participants who are invited for preparation of the Grant Agreement following the evaluation of

Еще в разделе: (Показать все результаты (>35) - ideas.msu.ru/ )

• http://ideas.msu.ru/docs/ERC_rules.pdf
• http://ideas.msu.ru/docs/fp7_rules.pdf
• http://ideas.msu.ru/docs/call_StG_2012.pdf

... Cultural Mediation of National History and Identity . ... Second International Conference in Tampere , Finland . ... This sense of national identity, of history and possible futures, is communicated by cultural and institutional forces and integrated, individually and collectively, into our sense of a common shared nationhood. ... Through a semiological analysis of television texts, it is demonstrated how, by a re-interpretation of Russian history, new cultural and national identities are...

Еще в разделе: (Показать все результаты (>8) - psyberlink.flogiston.ru/ )

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>10) - storage.bioinf.fbb.msu.ru/ )

... 2009 J. Opt. ... Opt. ... Coefficients a3 jx (z ), a3 jy (z ) ( j = x , y ), describing the quantities of the first order on the divergence angle of the beam in (7) are more complex, than a3x , y : a a a a my mx 2cos m emy = n m cos m + cos m 2cos m cos m emx = n m cos m + cos m a 3 jx (z ) = в + 4 cos 3 (S (z ) Ї e3 ) 4(S Ї e3 )g - r cos 3 + n 3 cos 3 k3 cos 3 ( j) (0) ( j) (z ) tan 3 - tan 3 tan 3 - n 2 tan 3 3 + sin2 3 (n 3 cos 3 + ... A 45 259ґ60 [21] Porras M A 1996 Opt. ...

Еще в разделе: (Показать все результаты (>34) - ilc.phys.msu.ru/ )

• Grant detail

html head title Перемещение слоя в режиме drag /title script language= javaScript !-- var app; var szx = 0 ; var szy = 0 ; function start_drag () { app = document.applets.red; app.open_change_mode(0); rc = app.set_current_layer(' show '); if( rc==-1 ) {alert( Нет указанного слоя show ); return ;} app.set_ drag _layer( show ); drag (); ...

Еще в разделе: (Показать все результаты (>20) - adept.srcc.msu.ru/ )

• http://adept.srcc.msu.ru/adept/java/applet_book/ch_box/ch2text1.htm
• http://adept.srcc.msu.ru/adept/java/applet_book/drag/drag2text1.htm
• http://adept.srcc.msu.ru/adept/java/applet_book/ch_box/ch1text1.htm

... Начало www.99ru.ru Книги о РУСИ Славянская традиция 8265 . ... Искусство . История.Философия . ... Художественные . ... История Всемирная . ... Искусство и культура . ... Другие виды искусства . ... Этнография Фольклор . ... Наследие Востока . ... Введите код товара из каталога. автор Велецкая Н.Н. Символы славянского язычества. руб. ... Велецкая Н.Н. Символы славянского язычества. ... Автор этой книги, отечественный славист с мировым именем - Наталья Николаевна Велецкая, делает такую попытку. ...

Еще в разделе: (Показать все результаты (>50) - www.bukivedi.ru/ )

• www.99ru.ru - TURNER, J. 2958
• www.99ru.ru - Tina Turner 16015
• www.99ru.ru - Burton L. Visotzky 3888

Application of the V--Ray Technology for Optimization of the TRFD and FLO52 Perfect Club Benchmarks to CRAY Y--MP and CRAY T3D Supercomputers Alexander S. Antonov, Vladimir V. Voevodin Moscow State University, Russia eґmail: voevodin@vvv.srcc.msu.su Abstract The paper shows an application of the soґcalled Vґ Ray Technology for optimizing the TRFD and FLO52 Perfect Club Benchmarks to CRAY Y--MP and CRAY T3D supercomputers. ... Results for CRAY YґMP supercomputers. al structure of the program. ...

Еще в разделе: (Показать все результаты (>9) - asa.guru.ru/ )

Automorphisms and isomorphisms of Chevalley groups of typ e G2 over lo cal rings with 1/2 and 1/3 E. I. Bunina M.V. Lomonosov Moscow State University Russia, 119992, Moscow, Leninskie Gory, Main Building of MSU, Faculty of Mechanics and Mathematics, Department of Higher Algebra email address: helenbunina@yandex.ru Abstract. ... We describe automorphisms of Chevalley groups of type G2 over local rings with 1/2 and 1/3. ... References [1] Abe E. Automorphisms of Chevalley groups over commutative rings. ...

Еще в разделе: (Показать все результаты (>11) - halgebra.math.msu.su/ )

• http://halgebra.math.msu.su/wiki/lib/exe/fetch.php/staff:yjabr12829.pdf
• http://halgebra.math.msu.su/wiki/lib/exe/fetch.php/staff:bunina:bunina_proofs.pdf

Chlorophyll Fluorescence in vivo : A Theory (Part I) . Most part of the photosynthetic pigments in phytoplankton cell reside in peripheral pigment-protein complexes of the light-harvesting antenna (I, see Fig. ... From peripheral antenna complexes, excitation is efficiently transferred to core antenna complexes near photosynthetic reaction centers (II, Fig. 1), where it can be used in the primary photochemical reaction of photosynthesis. ... and phytoplankton concentration . ...

Еще в разделе: (Показать все результаты (>10) - www.biophys.msu.ru/ )

• THE PRINCIPLES OF THE DOUBLE-FLASH FLUOROMETRY
• (Chlorophyll Fluorescence in vivo: A Theory

О кафедре . ... Динамические задачи теории упругости . Динамика пластин и оболочек . ... Методы теории упругости . ... Нелинейная теория упругости . ... Пластины и оболочки . ... Теория и расчет оболочек тонкостенных летательных аппаратов . ... Теория упругости структурно-неоднородных тел . ... Уравнения изгиба пластин классическая линейная теория. ... Колебания пластин. ... Oscillation of plates . ... МГУ им. М.В.Ломоносова, механико-математический факультет, кафедра теории упругости . ...

178. The NMW survey homepage

179. Founding Statutes

180. http://dfgm.math.msu.su/files/0articles/Ilyutko/ilyutko-JKTR.pdf