... A Primer from the Reform of Personal Income Taxation in Russia Introduction. ... However, to use the welfare function one needs to aggregate individual preferences that can also be unknown. ... The derivations lead to the conclusion that the optimal marginal income tax rate is increasing as the elasticity of labor supply increases. ... In this paper we obtain the characteristics of the labor supply for different population groups to get the elasticities of labor supply with respect to a post tax...
[
Текст
]
Ссылки http://e-journal.spa.msu.ru/uploads/vestnik/2004/vipusk_4._sentjabr_2004_g./nekipelov.pdf -- 233.1 Кб -- 06.07.2014 Похожие документы
... We describ e shortly new issues implemented in this version, namely, simplification of quark flavor combinatorics for the evaluation of hadronic processes, Les Houches Accord based CompHEP-PYTHIA interface, processing the color configurations of events, implementation of MSSM, symb olical and numerical batch modes, etc. ... This output can be written in L TEX format and in the form of CompHEP model files, which allows one to start calculations of processes in the new physical model. ...
[
Текст
]
Ссылки http://comphep.sinp.msu.ru/_media/download/hep-ph-0403113.pdf -- 165.7 Кб -- 13.09.2006 Похожие документы
List of publication by Sergey Petrushanko Список публикаций Петрушанко Сергея Владимировича 1999 1) M. Bedjidian, O. Kodolova and S. Petrouchanko, Dimuon Reconstruction in Heavy Ion Collisions Using a Detailed Description of CMS Geometry, CERN CMS Note 99/004 (1999). ... 33) S Chatrchyan, .. ... 2010 45) D. d'Enterria, G.Kh. ... Sergey Petrushanko et al (CMS Collaboration), Search for Dijet Resonances in 7 TeV pp Collisions at CMS, Phys.Rev.Lett.105:211801,2010 (2010); Phys.Rev.106:029902,2011 (2011). ...
... 1CWP SEQ 1 VVQPVIVEPIASGQGKAIKAWTGYSVSKWTASCAAAEAKVTSAITISLPN 50 1CWP STR TTTT TTTEEEEEEEE BTTTEEEEEE G 1CWP REM 1CWP REM . ... 1CWP ASG LYS A 42 1 C Coil 360.00 132.61 271.0 1CWP ASG ALA A 43 2 C Coil -118.96 139.41 98.3 1CWP ASG ILE A 44 3 C Coil -76.23 119.04 118.8 1CWP ASG LYS A 45 4 C Coil -77.21 153.95 187.6 1CWP ASG ALA A 46 5 C Coil -82.02 -177.46 33.6 1CWP ASG TRP A 47 6 T Turn -88.23 163.00 85.4 1CWP ASG THR A 48 7 T Turn -69.44 123.41 147.4 ...
... The experimental data obtained using Cherenkov light of EAS reflected from the snow surface of the Big Alma-Ata Lake (Kazakhstan) are presented. ... The balloon-borne measurements in the energy range 10 15 -10 20 eV are planned. ... SPHERE detector array was elaborated for balloon-borne experiment [3-5]. ... SPHERE detector was situated on the 160 m high mountain ledge nearby the B.Alma-Ata lake (2500 m above sea level) to detect Cherenkov light reflected from the snow surface of the lake. ...
... BMC Genomics 2013, 14:476 http://www.biomedcentral.com/1471-2164/14/476 RESEARCH ARTICLE Open Access The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences Evgeny V Leushkin1,2, Roman A Sutormin1, Elena R Nabieva1, Aleksey A Penin and Maria D Logacheva1,5* 1,2,3 , Alexey S Kondrashov 1,4 Abstract Background: Genlisea aurea (Lentibulariaceae) is a carnivorous ... Second, loss of genes could be involved. ... Plant Biol. ...
[
Текст
]
Ссылки http://storage.bioinf.fbb.msu.ru/~roman/bmc_genom_2013.pdf -- 1155.9 Кб -- 15.12.2013 Похожие документы
... -169130 S-131494 S-177796 S-177797 S-177799 S-177800 S-177801 S-177802 S-177803 S-177805 S-177806 S-177809 S-177812 - - IS-PCR and cyt b code cyt b sequence Length, bp 1110 429 - - - 230 379 - 476 - 481 - - 458 - 1140 464 - 276 - 1119 1140 1140 1120 1140 - - - 1137 - 713 - ... AY994368 - - - - - - AY994370 AB077278 (Ohdachi et AB077081 (Ohdachi et C. C. C. C. C. C. C. C. C. C. C. C. C. C. C. C. C. C. C. C. C. suaveolens suaveolens suaveolens suaveolens ... C. sibirica. ...
THOMSON ELECTRON X-RAY SOURCE FOR MEDICAL APPLICATIONS E.G. BESSONOV1, R.M. FESHCHENKO1*, M.V. GORBUNKOV1, V.I. SHVEDUNOV2 and A.V. VINOGRADOV1 1 2 P.N. Lebedev Physical Institute, 119991 Russia, Moscow Leninskii Prospect 53 Nuclear Physics Institute of Moscow State University, 119899 Russia, Moscow, Vorobyevy Gory Abstract A source of medical x-rays based on a 50 Mev storage ring and a quasi-continues picosecond laser is considered. ... Then the storage ring emittance is 0.1 mmmrad. ...
Experimentation and Personality , 1 Explicating the Black Box through Experimentation : Studies of Individual Differences and Cognitive Processes Howard Lavine Department of Political Science, SUNY Stony Brook Stony Brook, NY 11794-4392 Howard.Lavine@sunysb.edu Corresponding Author Milton Lodge Department of Political Science, SUNY Stony Brook Stony Brook, NY 11794-4392 Milton.Lodge@sunysb.edu James Polichak School of Law, University of Michigan ... The Authoritarian Personality. ...
[
Текст
]
Ссылки http://www.suny.msu.ru/ru/Lavine's%20article.pdf -- 94.0 Кб -- 24.08.2010
[
Текст
]
Ссылки http://suny.msu.ru/ru/Lavine's%20article.pdf -- 94.0 Кб -- 24.08.2010 Похожие документы
... However, derivation of its main equations from the free energy of a superconductor was only briefly described in the original paper [3], and some basic points of this procedure are still not completely understood. ... What is the sense of the free energy variation with respect to the vector potential of the magnetic field? ... Indeed, in practical calculations the GinzburgLandau equations are often used in combination with the GinzburgLandau free energy of the superconductor. ...
. Information Sources are organized by name. Books , Reports see below . Code . Name . Choose Reference(s) . AK . ( Atomki Koezlemenyek) (Atommag Kutato Intezet) . NTC . ((Chinese J.of) Nuclear Techniques, Shanghai.) In Chinese. Occasionally cited as (Chinese J.of) Nucl.Techniques in Science Res.,Industry,Medicine and Agriculture. Compare CNST Note: until 1986 no volume number was printed on the cover (in CINDA the year w . CSA . (Abstracts of papers, American Chemical Soc.) Abstracts of papers of the
... 2012 . ... Dissertation topic: "Bosnian question in Russian foreign policy, 1878 1908". ... Пахомова Л.Ю. Новая сравнительная хронология климатических и исторических событий в Северо-Восточной Европе (VIII-XVII вв.) ... Пахомова Л.Ю. Колебания климата высоких широт и освоение Северо-Восточной Европы в Средние века // История и современность. 2012. ? ... URL: http://e-journal.spa.msu.ru/vestnik/item/21_2009pakhomova.htm . ... Пахомова Л.Ю. Боснийский вопрос в российской внешней политике в 1878 1908...
... В процессе эволюции Вселенной малые начальные возмущения плотности нарастают, и в результате образуются гравитационно-связанные (вириализованные) сгустки - гало (в уоторых затем образуются галактики или скопления галактик). ... Полученные ведущими мировыми группами численные результаты показывают, что гало характеризуются радиальным профилем плотности вида r-1 в центре, т.е. имеется расходимость плотности (касп). ... Известно, что при эволюции такой системы образуется гало с каспом r-1 в центре. ...
[
Текст
]
Ссылки http://hit-conf.imec.msu.ru/2012/abstracts/Pilipenko_tezisy.doc -- 21.5 Кб -- 14.06.2015 Похожие документы
... Руководитель: проф. И.П. Ермаков ; . Научные кадры: c.н.с. Н.П. Матвеева , c.н.с. М.А. Брейгина , аспирант Н.М. Максимов. ... Изучение механизмов их действия на клеточном уровне и влияния на репродуктивную сферу важно для понимания особенностей стресс-физиологии растений. ... Брейгина М.А., Смирнова А.В., Матвеева Н.П., Ермаков И.П. Изменения мембранного потенциала в процессе прорастания пыльцевого зерна и роста пыльцевой трубки // Цитология. ...
О ЛОКАЛЬНО-СБАЛАНСИРОВАННЫХ 2-РАЗБИЕНИЯХ НЕКОТОРЫХ ДВУДОЛЬНЫХ ГРАФОВ Баликян С.В. В работе получено необходимое и достаточное условие существования такого разбиения множества вершин двудольного графа G, в котором любые два простых цикла имеют не более одной общей вершины, на два непересекающихся подмножества V1 и V2 , при котором для любой вершины v V (G) выполняется неравенство ||(v) V1 | ... Пусть A множество графов, в которых любые два простых цикла имеют не более одной общей вершины. ...
... Ионные равновесия в растворах.. ... Рассчитайте молярную концентрацию KNO3 в растворе, полученном | ... Рассчитайте рН 0,015 моль/дм3 раствора валериановой кислоты | ... Буферная емкость - число молей сильной кислоты или сильного основания, которые нужно добавить к 1 л раствора, чтобы изменить pH на единицу. |[pic] |[pic] |[pic] | ... Изобразите на одном рисунке кривые титрования 0,1000 М раствора железа(II) и 0,1000 М раствора ртути(II) 0,1000 М раствором ЭДТА при одинаковом pH, если [pic], а [pic]...
[
Текст
]
Ссылки http://analyt.chem.msu.ru/edu_materials/posobie-pharm-ii-zadachi.doc -- 2356.5 Кб -- 01.09.2014 Похожие документы
... Главная Научная деятельность Научная деятельность факультета политологии МГУ . В 2011 году факультет политологии МГУ организовал ряд крупных научных мероприятий, среди которых особое место занимает Всероссийский научно-образовательный форум ?Политология ? ... К 40-летию кафедры истории социально-политических учений факультета политологии МГУ имени М.В.Ломоносова была приурочена Международная научная конференция ?Политика в текстах ? ... Поступление на факультет политологии в 2016 году . ...
... Библиотека / The Somoninge of Everyman . ... GOD . ... EVERYMAN . ... FELAWSHIP . ... GOODES . ... GOOD DEDES . ... In my glory sholde make his mansion, . ... Where arte thou, Deth, thou mighty messengere? ... Hast thou thy Maker forgete? ... Thy many badde dedes, and good but a fewe, . ... And yet, if thou wilte ete, and drinke, and make good chere, . ... Good Dedes, I praye you helpe me in this nede, . ... Helpe my Good Dedes for my piteous exclamacion! . ... The Good Dedes shall make all sure. ...
... 21, No. 1, pp. 106128 c 1999 Society for Industrial and Applied Mathematics ON SINGULARITIES OF A BOUNDARY OF THE STABILITY DOMAIN ALEXEI A. MAILYBAEV AND ALEXANDER P. SEYRANIAN This paper is dedicated to V. I. Arnold on the occasion of his 60th birthday. ... ON SINGULARITIES OF A BOUNDARY OF THE STABILITY DOMAIN 115 Fig. ... ON SINGULARITIES OF A BOUNDARY OF THE STABILITY DOMAIN 119 Let us calculate the vectors hj , j = 1, 2, 3, defining collapse of a triple zero eigenvalue of the matrix A (0). ...