... SPAND- `TO LIBATE': ONE MORE CASE OF LUVIAN INFLUENCE ON NEW HITTITE It is well-known that the syllabic cuneiform writing is not fit for the unambiguous representation of word-initial consonant clusters.1 The phonological sequence /C1C2-/ can only be represented as either C1V-C2V- or VC1-C2V- in syllabic orthography, and in neither of the two cases can one be a priori sure whether the vocalic component of the first syllabic sign is phonetically real. ... On initial *sm- in Hittite, cf. ...

Еще в разделе: (Показать все результаты (>12) - imk.msu.ru/ )

• http://www.imk.msu.ru/Structure/Linguistics/yakubovich/download/lydian.pdf
• http://www.imk.msu.ru/Structure/Linguistics/yakubovich/download/refl-ucla.pdf
• http://www.imk.msu.ru/Structure/Linguistics/yakubovich/download/palaic1.pdf

Cassa depositi e prestiti spa Long-Term Instruments for financing Infrastructure Franco Bassanini Chairman of Cassa Depositi e Prestiti Institute of the Russian Academy of Sciences September 22, 2010, Moscow Cassa depositi e prestiti spa Global capitalism and short-termism · The short-termism that characterized recent global capitalism had negative effects on the ...

Еще в разделе: (Показать все результаты (>20) - www.mse-msu.ru/ )

• http://www.mse-msu.ru/Maevsky,%20Zorin%20-%20Managed%20monetary%20accelerator.pdf
• http://www.mse-msu.ru/Russia_2010_MSE_en.pdf
• http://www.mse-msu.ru/Nekipelov_France_2010_Text_Eng.pdf

NEW ECONOMIC SCHOOL .. BSP/2007/094 R 2007 " " .. ... On The Dynamics of People's Unions / Working Paper # BSP/2007/094 R. - Moscow, New Economic School, 2007. - 19 p. (Rus.) ... Key words: public economics, allocation theory, size of nations ISBN ї .. ... x[0,1] - (FOC) FOC: (W1 (x) + W2 (1 - x)) = 0, x (1) - (SOC) SOC: 2 (W1 (x) + W2 (1 - x)) 0. x2 (2) , (1) (2), .. ... Grossman & Mendoza, 2001, 2004) , , , : , . ... On the Number and Size of Nations", Quarterly Journal of Economics Vol. ...

Еще в разделе: (Показать все результаты (>10) - belyakov.imec.msu.ru/ )

• http://belyakov.imec.msu.ru/papers/Belyakov_eng.pdf
• Anton O. Belyakov

... Academic Departments . ... Partners . ... All partners . ... 05.04.2013 On March 29 Professor Robert Weisbrot (Colby College, USA) delivered a lecture at the Faculty of Journalism, Lomonosov Moscow State University. ... The lecture was part of the exchange program between Faculty of Journalism, MSU and Colby College. Earlier in March Associate Professor at the Faculty of Journalism, Dr. Mikhail Makeenko lectured on the topic "Censorship and the Media in Putin s Russia" at Colby . ...

Еще в разделе: (Показать все результаты (>51) - www.journ.msu.ru/ )

• The 5th International Media Readings in Moscow "Mass Media and Communications ?
• Television and Radio Broadcasting :: Department of Journalism, M. V. Lomonosov
• Periodical Press :: Department of Journalism, M. V. Lomonosov Moscow State

... ICONO Invited Speakers . ... Gennadiy Kulipanov, Budker Inst. of Nuclear Physics, Russia . ... Marlan Scully, Texas A&M Univ., ... Andrey Goncharov, Inst. of Laser Physics, Russia . ... Vladimir Trunov, Inst. of Laser Physics, Russia . ... Since 1987, he has worked at the National Research Council of Canada (Ottawa) in the field of laser physics and trapped ion optical frequency standards. ... Alexey Taichenachev , Inst. of Laser Physics, Russia . ... S. Vatnik, Inst. of Laser Physics, Russia . ...

Еще в разделе: (Показать все результаты (>11) - iconolat13.phys.msu.ru/ )

• Excursions
• Housing and travel

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>11) - storage.bioinf.fbb.msu.ru/ )

LOCAL TSUNAMI WARNING AND MITIGATION ________________________________________________________________________________________________________________________________________ HYDROACOUSTIC ANTENNA : A POWERFUL TOOL TO FORECAST TSUNAMIGENIC EARTHQUAKES Yakov S. Karlik Central Research Institute MORPHYSPRIBOR , 46 Chkalovsky proezd, Sankt-Petersburg, 197378 Russia E-mail: karlik@mail.cl.spb.ru ABSTRACT Hydroacoustic antenna ... 2001). ... Eiby, J.A., 1982: Earthquakes. ...

Еще в разделе: (Показать все результаты (>22) - seac47-2.phys.msu.ru/ )

• http://seac47-2.phys.msu.ru/proc/E02_Cochran.pdf

Twilight observations with MASS/DIMM B. Safonov Sternberg Astronomical Institute Moscow State University Comprehensive Characterization of Astronomical Sites, 2010 B. Safonov (Moscow State University) Twilight observations with MASS/DIMM SITE 2010 1 / 17 Why observe in twilight with MASS/DIMM? ... ASM includes 3 devices sensitive to background: guider, DIMM and MASS. B. Safonov (Moscow State University) Twilight observations with MASS/DIMM SITE 2010 2 / 17 Background in guider. ...

Еще в разделе: (Показать все результаты (>24) - site2010.sai.msu.ru/ )

• http://site2010.sai.msu.ru/static/doc/Site2010-Summary.pdf
• Information

ISSN 1060 992X, Optical Memory and Neural Networks (Information Optics), 2013, Vol. ... The used architectures of ANN allow detecting fluorescence of carbon dots against the background of proper fluorescence of egg protein with reasonably high accu racy­not worse than 0.002 mg/mL. ... This methodology includes elaboration of procedure of data preparation, determination of optimal neural network architectures, algorithms and parameters of their training. ... This is unfavorable for ANN training. ...

Еще в разделе: (Показать все результаты (>25) - rswater.phys.msu.ru/ )

• http://rswater.phys.msu.ru/en/articles/2014/Using.pdf
• Group of laser spectroscopy of solutions of supramolecular compounds and
• Dmitry M. Karpov

... Data . ... Models . ... Paraboloid model represents the magnetic fields in the Earth's magnetosphere as a superposition of the ring current B r , of the tail current including the closure currents on the magnetopause B t , of the Region 1 field-aligned currents B fac , of the magnetopause currents screening the dipole field B sd and of the magnetopause currents screening the ring current B sr : . ... the ring current magnetic field at the Earth's center b r ; . ... Magnetic field at MD outer edge . ...

Еще в разделе: (Показать все результаты (>26) - smdc.sinp.msu.ru/ )

• COSRAD model - Space monitoring data center
• IGRF10 model - Space monitoring data center

... Conference Venue . ... Latest achievements in the field of humic substances and natural organic matter (NOM) research . Theory and practice of a directed use of humic substances and other biologically active compounds in crop production and animal feed . ... Organic farming and ecoadaptive agriculture: the role of humic substances and other biologically active compounds . ... The school on isolation of humic substances (HS) using solid phase extraction (SPE) cartridges . ...

Еще в разделе: (Показать все результаты (>109) - mgumus.chem.msu.ru/ )

... The linguistic aspects of the model and the properties of the semantic dictionary ensuring the content analysis with compression of the text structure are considered. Our dictionary resources serve an instru- ment for building a multilevel textual semantic structure. ... Reason (A,B), where SemF(A) = SIT or a whole semantic formula; the same for SemF(B). ... Sem(SIT)R . ... Semantic Resources for Textual Content Compression // Fourth International Conference on Meaning-Text Theory (MTT'09). ...

Еще в разделе: (Показать все результаты (>4) - leontyeva.srcc.msu.ru/ )

• Lexical Resources for Personal Data Recognition in Texts

... The data on UV glow of the atmosphere obtained in operation of one pixel of the TUS detector on board the Moscow State University "Universitetsky-Tatiana" satellite was taken into account in design of the updated TUS detector. ... The main feature of the design is use of MEMS technology scanning mirror controlled by the TUS computer, analyzing the recorded EAS data and directing the laser to the atmosphere spot, where back scattered Cherenkov light came from. ... Monitoring of UV intensity on-route....

Еще в разделе: (Показать все результаты (>3) - cosrad.sinp.msu.ru/ )

... Universitetskaya 1, Izhevsk, 426034 Russia Abstract This pap er investigates the p ossibility of the motion control of a ball with a p endulum mechanism with non-holonomic constraints using gaits -- the simplest motions such as acceleration and deceleration during the motion in a straight line, rotation through a given angle and their combination. ... This paper investigates the control led motion of a ball with a pendulum. ... The angular velo city of the pendulum has the form 2 = . ...

Еще в разделе: (Показать все результаты (>113) - ics.org.ru/ )

• Institute of Computer Sciences - Publications

Alexander P. Seyranian . Institute of Mechanics , . Moscow State Lomonosov University , . ... Phone: (7495) 939 2039 . Fax: (7495) 939 0165, 939 2065 . ... My field of specialization are Stability Theory, Parametric Resonance, Gyroscopic Stabilization, Mechanics of Solids, Structural Optimization, Singularities and Bifurcations. ... Technical University of Denmark . Aalborg University, Denmark . ... Institute of Engineering Mechanics and Systems, University of Tsukuba, Japan . ...

Еще в разделе: (Показать все результаты (>2) - seyranian.imec.msu.ru/ )

THOMSON ELECTRON X-RAY SOURCE FOR MEDICAL APPLICATIONS E.G. BESSONOV1, R.M. FESHCHENKO1*, M.V. GORBUNKOV1, V.I. SHVEDUNOV2 and A.V. VINOGRADOV1 1 2 P.N. Lebedev Physical Institute, 119991 Russia, Moscow Leninskii Prospect 53 Nuclear Physics Institute of Moscow State University, 119899 Russia, Moscow, Vorobyevy Gory Abstract A source of medical x-rays based on a 50 Mev storage ring and a quasi-continues picosecond laser is considered. ... Then the storage ring emittance is 0.1 mmmrad. ...

Еще в разделе: (Показать все результаты (>7) - miles.sinp.msu.ru/ )

• http://miles.sinp.msu.ru/files/Instr&Exp_Tech_Engl.pdf
• http://miles.sinp.msu.ru/files/Berlin06_Source.pdf

... Recreational Geography and International Tourism . ... Physical Geography and Landscape Science . ... Science . ... According to the fact that ecological conflicts has a global scale in international watersheds, transboundary location of Selenga river complicates the problem of scientific resolution of the conflicts between water consumers. ... International programme in Natural Resource Management and Law offers a unique combination of Natural and Environmental Sciences and Science of Law. ...

Еще в разделе: (Показать все результаты (>5) - www.eng.geogr.msu.ru/ )

... This article caused a most lively interest from the readers, and received more than a hundred responses, which contained various versions of construction methods of the Sri Yantra. ... In this way he revealed a good correspondence between the concentric levels built by him in this relationship of the three Sri Yantra and the orbits of the planets of the solar system (Fig. 10, shows the first two out of three stars examined by him) with a divergence from the real diameters of orbits of about 1.5%. ...

Еще в разделе: (Показать все результаты (>16) - www.protein.bio.msu.ru/ )

• http://www.protein.bio.msu.ru/~akula/coherence.pdf

... Statistics One, Lecture 3, example script # Read data, plots histograms, get descriptives library("psych") ratings . Statistics One, Assignment One Statistics 1, Assignment 2 . ... Дайджест психологических исследований . ЖЖ-сообщество ?RU_SPSS? ... Сервер виртуальных исследований . Скачать SPSS . Статистика блога . ... R-советы: Экономим время и место на диске путем сжатия файла данных . ... Yurij Tukachev on Twitter Counter Вам нравятся материалы блога? ...

Еще в разделе: (Показать все результаты (>24) - tukachev.flogiston.ru/ )

• Tag: R
• Category: Новости

... Anti thrombin DNA aptamers were immobilized on silica microspheres, placed inside microwells on the distal tip on an imaging optical fiber, coupled to a modified epifluorescence microscope through its proximal tip. ... It should be mentioned that since thrombin is not a DNA binding protein, the possibility to elicit thrombin­aptamer complexes clearly demonstrates the power of SELEX technology. ... Specificity of aptamer coated beads for F thrombin binding was assessed with bovine serum albumin. ...

Еще в разделе: (Показать все результаты (>6) - rnp-group.genebee.msu.ru/ )

• http://rnp-group.genebee.msu.su/pdfs/MolBio6_00KopylovLO.pdf
• http://rnp-group.genebee.msu.ru/pages/pdf/nar2004.pdf
• http://rnp-group.genebee.msu.ru/pages/pdf/biochem2003.pdf