... The last years give the experimental evidence of two such states at mass 1.4 GeV/c 2 and 1.6 GeV/c 2 [2, 3, 4, 5, 6, 7, 8, 9]. ... It removes such kind of ques­ tions as the correct calculation of the different apparatus acceptance, some distinctions of partial wave analysis, the different background contributions. So the evidences of 1 + exotic states at mass 1.4 GeV/c 2 (p 1 (1400)) and 1.6 GeV/c 2 (p 1 (1600)) are very weighable. ... There is another question concerning to the 1 + exotic decay. ...

Еще в разделе: (Показать все результаты (>46) - lav01.sinp.msu.ru/ )

• Photos related to Igor Lokhtin
• Photos related to Olga Kodolova

... An Analysis of Modern Discrete Movements of the Earth's Crustal Blocks in Geodynamically Active Regions Based on GPS Data V. S. Zakharov and D. A. Simonov Moscow State University, Moscow, 119991 Russia e mail: zakharov@dynamo.geol.msu.ru; simon@geol.msu.ru Received March 24, 2009 Abstract--In this work original algorithms are proposed that allow us to provide a set of points (clusters) on a surface that are in cooperative motion, on the basis of an analysis of GPS data. ... Method O1. ...

Еще в разделе: (Показать все результаты (>24) - dynamo.geol.msu.ru/ )

• http://dynamo.geol.msu.ru/personal/vsz/papers/Koronovsky_etal_2015_eng.pdf
• Textbooks - Dynamic Processes in Geology
• Summaries of articles

. Название публикации . Nuclear Magnetic Resonance Spectroscopy in Solving the Analytical Problems of Medicine: Analysis of Cerebrospinal Fluid . Авторы . T.N. Kolokolova, O.Yu. Savel'ev, N.M. Sergeev, O.A. Shpigun, K.V. Sokolov, V.I. Skvortsova . Дата . 31.12.2009 23:00:00 . Название журнала . Journal of Analytical Chemistry. Том . Vol.65 . Номер . 10. первая страница . 1073 . последняя страница . 1081. Купить нет на складе . 2009 ФФМ МГУ, 2009

Еще в разделе: (Показать все результаты (>9) - fbm.msu.ru/ )

All PostScript files are compressed by gzip. ... Carrier transport and non-equilibrium phenomena in doped PbTe and related materials. - physica status solidi (a), 1993, 137 , 9-55 ( PostScript file ) ( PDF file ). ... Physics Reports, 1995, 257 , 85-131 ( PostScript file ) ( PDF file ). ... Phys., 1999, 86 , No 6, 3241-3246 ( PostScript file ) ( PDF file ). ... 1999, 14 , No 9, 852-856 ( PostScript file ) ( PDF file ). ... Вестник МГУ, Сер. физ., 2000, в.1, 39-43 ( PostScript file ) ( PDF file ). ...

Еще в разделе: (Показать все результаты (>17) - lizard.phys.msu.su/ )

Summary Progress Report 2010 ­ 2014 UNESCO Chair on Global Problems and Emerging Social and Ethical Challenges for Large Cities and Their Population at the Faculty of Global Processes of the Lomonosov Moscow State University Period of activity: September 2010 June 2014 Title of the Chair : UNESCO Chair on Global Problems and Emerging Social and Ethical ... Visit of UNESCO Director-General Irina Bokova at Moscow State University September 9, 2011. ...

Еще в разделе: (Показать все результаты (>1597) - fgp.msu.ru/ )

• http://fgp.msu.ru/wp-content/uploads/2013/12/Luce_Moscow_2013_small.pdf
• http://fgp.msu.ru/wp-content/uploads/2014/09/UNESCO_CHAIR-2.pdf
• http://www.msu.ru/en/admissions/general-programs/docs/FACULTY%20OF%20GLOBAL%20STUDIES.pdf

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>11) - storage.bioinf.fbb.msu.ru/ )

... education . research . ... Fundamentals of Nanotechnology . ... Molecular physiology . ... Pass/fall exam: 5 p.m., 22 May, 2009 (those third-year students who pass the exam undertake further study majoring in Nanosystems and Nanodevices , Functional Nanomaterials , Nanobiomaterials and Nanobiotechnology). ... 10 February 2009 . ... Prof. Yu. ... Work of molecular motors: ATP synthetase, photosynthetic reaction centers, retinal containing photosensitive proteins (rhodopsin, bacteriorhodopsin.) ...

Еще в разделе: (Показать все результаты (>15) - nano.msu.ru/ )

• MSU Nanotechnology Education and Research Center. Mission. | MSU Nanotechnology
• Fundamentals of Nanotechnology, 2009 | Научно-образовательный центр по

... Processes of regionalization in Post-Soviet space: contradictions of Russia-Belarus Integration. Moscow, Institute of economy RAS, 2010. ... Eurasian Economic Integration. ­ 2010, 1. 4. 10 years of EurAsEC: everything is just starting (in co-authorship with R. Grinberg)./ ... Scientific Reports of the Institute of Economics of RAS. ... Analytical Bulletin of the Centre for Problems of Globalization and Integration of Institute of economics of Russian Academy of Sciences", 2007, Issue 4 (12). ...

Еще в разделе: (Показать все результаты (>25) - www.mse-msu.ru/ )

• http://www.mse-msu.ru/Ayvazyan_Introduction_to_the_textbook_on_econometrics.pdf
• http://www.mse-msu.ru/Nekipelov_France_2010_Slides_Eng.pdf
• http://www.mse-msu.ru/Russia_2010_MSE_en.pdf

... Furman and A.V.Tikhonravov, "Basics of optics of multilayer systems" , Editions Frontiers, Gif-sur Yvette, 1992, 242 p. A.V. Tikhonravov, M.K. Trubetskov, I.V. Zuev and P.G. Verly, "Efficient Refinement of Inhomogeneous Optical Coatings", in "Optical Interference Coatings", OSA Technical Digest Series, vol. ... A.V. Tikhonravov, M.V. Klibanov, I.V. Zuev, "Numerical study of the phaseless inverse scattering problem in thin film optics", Inverse problems, 1995, Vol. 11, pp. ... Основные публикации . ...

Еще в разделе: (Показать все результаты (>36) - www.srcc.msu.ru/ )

... SPAND- `TO LIBATE': ONE MORE CASE OF LUVIAN INFLUENCE ON NEW HITTITE It is well-known that the syllabic cuneiform writing is not fit for the unambiguous representation of word-initial consonant clusters.1 The phonological sequence /C1C2-/ can only be represented as either C1V-C2V- or VC1-C2V- in syllabic orthography, and in neither of the two cases can one be a priori sure whether the vocalic component of the first syllabic sign is phonetically real. ... On initial *sm- in Hittite, cf. ...

Еще в разделе: (Показать все результаты (>24) - imk.msu.ru/ )

• http://www.imk.msu.ru/Structure/Linguistics/yakubovich/download/refl-ucla.pdf
• Ilya Yakubovich. Institute of World Culture
• Index of /Structure

... Seminars . ... Group 417 [ PDF ] Students are expected to attend lectures and seminars which is the standard forum for class communication. ... Some of the homework problems might appear on the tests and the exam. ... Your class grade total percentage is given by 40% seminar and homework, 25% first test and 35% second test. ... Students with the class grade 5 and 4 may get a final course grade without a final exam, but only upon the recommendation of seminar assistants. ... Test 1 [ PDF ] . ...

Еще в разделе: (Показать все результаты (>38) - nanofluidics.phys.msu.ru/ )

• Belyaev
• Research

... Destructive effects of many tsunamis are confined to areas within about one hour of the initial propagation time (that is, within a few hundred km of their source). ... Two international tsunami workshops have recently been held in Russia ( "Tsunami Mitigation and Risk Assessment," Petropavlovsk-Kamchatskiy,1996 , and "Tsunami Risk Assessment Beyond 2000: Theory, Practice and Plans," Moscow, 2000). ... The final product of the workshop will be recommendations on local tsunami warning and mitigation....

Еще в разделе: (Показать все результаты (>26) - seac47-2.phys.msu.ru/ )

• LOCAL TSUNAMI WARNING AND MITIGATION

Studying at MU Programs and degrees . ... Moscow State University provides a wide range educational services and educational programmes. ... International students are offered Bachelour (4 years full time) and Master programmes (2 years full time). A number of our faculties train both domestic and international students according to Bachelour and Master programmes with granting Bachelour and Master diplomas. ... Please, contact International Students Office for information on the topics offered. ...

Еще в разделе: (Показать все результаты (>75) - www.ied.msu.ru/ )

... The technique had been developed for calculating destruction of melting vitreous bodies in hypersonic gas flows taking into account the internal radiative transfer. ... The problem of flow in the chemically non-equilibrium boundary layer at a stagnation point of blunt body had been solved by the asymptotic method and formulas for the heat and diffusion fluxes to a surface of any catalycity had been obtained. ...

Еще в разделе: (Показать все результаты (>6) - lab106.imec.msu.ru/ )

... Форумы > Аспирантура > Тема . ... PhD position in the University of Florida . PhD position is available in the department of Industrial and Systems Engineering, University of Florida. ... Risk Management and Financial Engineering Lab website: http://www.ise.ufl.edu/rmfe/ . ... Statistical estimation in terms of factor models can be tuned to risk preferences in order to achieve better performance when applied to portfolio optimization. ... University of Florida, November 2011. ...

Еще в разделе: (Показать все результаты (>208) - www.mmonline.ru/ )

• MMOnline | Форумы | Преподаватели | А.Т. Фоменко
• Программа конференции "Fundamental Mathematics Today"
• MMOnline | Форумы | Книжная барахолка | Уже нашлось Ищу: Leveque R.J. Finite

Transhumus : Integrated software solution for interpretation of FT-ICR mass spectra of natural organic matter Anton Grigoryev1, 2, Alexey Kononikhin 1 2 2, 3 , Irina Perminova4, Eugene Nikolaev2, 3 ansgri@gmail.com Institute for Energy Problems of Chemical Physics, Moscow , Russia 3 Institute of Biochemical Physics, Moscow , Russia 4 Lomonosov Moscow State University, Moscow , Russia Natural organic matter ( ... However, there still are problems with interpretation of mass spectra of NOM. ...

Еще в разделе: (Показать все результаты (>134) - mgumus.chem.msu.ru/ )

• http://www.mgumus.chem.msu.ru/publication/2013/2013-Kostyukevich-etal.pdf
• http://www.mgumus.chem.msu.ru/publication/2009/2009-kunenkov-total.pdf
• http://www.mgumus.chem.msu.ru/publication/2010/2010-kazachkov-optimization.pdf

Announcement On November 2-3, 2005 Lomonosov Moscow State University will conduct jointly with the Academy of Cryptography of the Russian Federation the Fourth All- Russian Conference Mathematics and Security of Information Technologies [Cybersecurity?] and jointly with the Center of International Studies, Cambridge University , United Kingdom, Advanced Research Workshop Unconventional ... Sherstyuk V.P. - Security Council of the Russian Federation; 3. ... Organization Committee 1. ...

Еще в разделе: (Показать все результаты (>21) - suny.msu.ru/ )

• http://suny.msu.ru/ru/ProgramMaBIT05En.doc
• Центр по делам России и США :: Новости
• Center on Russia and the United States :: Other Russian Programs

The Octotron Approach: Towards Autonomous and Reliable Operation of Supercomputers Alexander Antonov, Dmitry Nikitenko, Pavel Shvets, Sergey Sobolev, Konstantin Stefanov, Vadim Voevodin, Vladimir Voevodin, Sergey Zhumatiy Research Computing Center, Lomonosov Moscow State University, Moscow, Russia {asa,dan,shpavel,sergeys,cstef,vadim,voevodin,serg}@parallel.ru 1 Introduction ... 2 The Octotron System: Model-based Approach Octotron represents the supercomputer model in the form of a graph (Fig. ...

Еще в разделе: (Показать все результаты (>51) - hpc.msu.ru/ )

• X-COM: DISTRIBUTED COMPUTING SOFTWARE | Moscow University Supercomputing Center

Contemporary interpretation of morphology as a way of obtaining new data on the ecology and evolution of vertebrates (exemplified by birds) Felix Ya. ... 1950, 1957, 19706, 1974, 1983), - . ... 1997) ".. ... 1974; , , 1977; , 1982, 1991; Korzun et al., ... 1957, 19706, 1983), . ... 1958, 1965; Bock, 1964; , 1972, 1982, 1997; , 1978; Zusi, 1984 ), , , - . Zusi, 1974) . ... 1961, 1965). ... 1974). ... 1965, . ... 19706,1974,1983). ... 1965, 1970; , 1972). ... 1982, . ... 1964, Vol. ... 1972, Vol. ...

Еще в разделе: (Показать все результаты (>56) - vertebrata.bio.msu.ru/ )

• Laboratory of Ornithology
• Department of Vertebrate Zoology
• Tatyana A.Ilyina

... Scientific goals . ... Automatic gaze stabilization corrector . Scientific equipment . ... IMISS-1 . ... Comparing the measured and calculated values we?ll find out if it is possible to use microelectromechanical inertial measuring modules in an automatic gaze stabilization corrector , and calculate the value of changes of microsensors? instrumental errors under the space conditions as against the Earth ones. ...

Еще в разделе: (Показать все результаты (>36) - lomonosov.sinp.msu.ru/ )

• BDRG | Университетский спутник "Ломоносов"
• DEPRON | Университетский спутник "Ломоносов"
• ELFIN-L | Университетский спутник "Ломоносов"