... 2 · ­ , , · ­ · ­ , 03.12.2015 . ... 14 03.12.2015 · · · 03.12.2015 . ... Verifier Uni ve rsi ty of Te x as 2013 Anteater Uni ve rsi ty of Il l i noi s 2011 FlowChecker Uni ve rsi ty of North Carol i na 2010 VERMONT Network disjoint Port #02 Port #03 h2 h3 s1 Port #01 h1 Port #04 h4 main: disjoint() := Forall[x, out_x, y, out_y: !R(x, out_x) or !R(y, out_y) or x[p] == out_y[p] and out_x[p] == y[p] or x VERMONT proxy CLI Packets are delivered through the control plane We can block them! ...

Еще в разделе: (Показать все результаты (>7) - lvk.cs.msu.su/ )

• http://lvk.cs.msu.su/~bahmurov/course_simulation/2015/tut_ipm_01_gpss.pdf

... Study (Michael & Houchin 1979) is an example of one of the first nonparametric approaches to EEG segmentation. ... As we noted, the main disadvantage of this approach to segmentation was the lack of adaptability of segment boundaries to the actual piecewise stationary structure. ... One may also expect that the change-points can reveal the consecutive operations of neuronal networks, with different time scales according to parameters of the algorithm of change-point detection (Kaplan et al. 1997b). ...

Еще в разделе: (Показать все результаты (>61) - brain.bio.msu.ru/ )

• Change-points at different levels of the hierarchy of EEG segmental...
• Change-points in multi-channel EEG
• Change-points in EEG components with different pattern

... В левой части открывшегося окна Group Policy найдите раздел Local Computer Policy | ... Windows Update . ... Дважды щелкните по строке Configure Automatic Updates , в открывшемся окне поставьте переключатель в положение Enabled. ... Задав настройки для параметра Configure Automatic Updates, щелкните Next Policy и в окне Specify intranet Microsoft update service location Properties поставьте переключатель в положение Enabled, а в обоих полях ввода текста обязательно введите http://wsus.chem.msu.ru . ...

Еще в разделе: (Показать все результаты (>2) - netadmin.chem.msu.ru/ )

... Many presentations concern interesting work, but are nevertheless difficult to follow because the speaker unknowingly makes a number of presentation errors. ... Time 1 Conclusion Audience Attention Introduction Various Themes Efficient Presentation Intermediate Conclusion Intermediate Conclusion Average Presentation Figure 2 Ideal attention curve of an audience when the speaker divides his talk in recognizable parts, each summarized by intermediate conclusions. ... What is a successful poster? ...

Еще в разделе: (Показать все результаты (>30) - www.kge.msu.ru/ )

• IVAKIN YURY DMITRIEVICH

4 SPIN. ... 0 1 Hello, world! ( ) ";" , active proctype main() { printf("Hello, world!\n") } ­ , >spin hello.pml Hello, world! 1 process created Hello, world! ... mtype = { P, C }; mtype turn = P; active proctype producer() { do :: ( turn == P) - printf( Produce\n ); turn = C od } active proctype consumer() { do :: ( turn == C) - printf( Consume\n ); turn = P od } ( 1) ­ 0, (op on sequence) (guard) ­ mtype = { P, C }; mtype turn = P; active proctype producer() { do :: ( ...

Еще в разделе: (Показать все результаты (>4) - savenkov.lvk.cs.msu.su/ )

... Geography of World Economy . ... Recreational Geography and International Tourism . ... Physical Geography and Landscape Science . ... Field stations . ... Educational council . Science . ... International commission on continental erosion . ... Field training . ... Type of field courses . ... Interuniversity council for erosion and fluvial.. ... International programme in Natural Resource Management and Law offers a unique combination of Natural and Environmental Sciences and Science of Law. ...

Еще в разделе: (Показать все результаты (>110) - eng.geogr.msu.ru/ )

• Interdisciplinary seminars
• Department of Land Hydrology
• Department of Meteorology and Climatology

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>9) - storage.bioinf.fbb.msu.ru/ )

• http://storage.bioinf.fbb.msu.ru/~roman/Sutormin_CV_aug2014.pdf

... Таня Трубичева, Коля Чеботарев, Сергей Меженный, Андрей Лебедев . ... Слева направо: Паша Зинюков, Булат Мавлюдов, Галя Ивутина (выше), Муся Григорян, Саша Игнатьев. ... Слева направо: 1)Аня Ноздрачева, 2)Дима Китаев, 3)Миша Ноздрачев, 4)Женя Цибиков, 5)Костя Фирсов, 6)Володя Трифонов, 7)Тамара Голубицкая, 8)Таня Михайлина, 9)Саша Игнатьев, 10)Валя Рябинкина, 11)Таня Чеботарева, 12)Оля Гусева, 13)Коля Чеботарев. ... Таня Гужва, Таня Немченко, Даниэль Усиков перед спуском в снежную . ...

Еще в разделе: (Показать все результаты (>12) - optics.sinp.msu.ru/ )

• polist99
• zagedan

Moscow Astronomical Plate Archives: . Contents, Digitization, Current and Possible Applications . ... We describe the astronomical plate archives in Moscow and Zvenigorod and the existing digitization projects. ... 2 The Plate Archive of the Sternberg Institute . The contents of the most important Moscow astronomical plate archive, that of the Sternberg Astronomical Institute, was briefly presented in Shugarov et al. [1] in 1999. ... THE MOSCOW PLATE COLLECTION (STERNBERG INSTITUTE) . ...

Еще в разделе: (Показать все результаты (>27) - www.sai.msu.ru/ )

• Index of /groups/cluster/gcvs/digit/mdv
• Отдел внегалактической астрономии: ГАИШ Extra-galactic astronomy Group Staff

Session Start: Thu Sep 04 15:17:41 1997 . ASA_ECTb> Уж приходит дождливая осень . JamOUT> На окне - капли стылые дня . ... Master_> О чем сказал? ... Valka> где кажется весь мир земной . Sol> избавлен от ночной проказы . ... Sol> значит, далеко еще метели. ... Sol> значит снова ветер дует в грудь, . ... Master> Значит снова наступил рассвет . Valka> Значит не один на этом свете, . ... ASA_ECTb> Значит, Бог судьбу твою отметил . Master> Значит жить нам вместе много лет. ...

Еще в разделе: (Показать все результаты (>19) - asa.guru.ru/ )

• Буриме от 5 сентября 1997 года
• Буриме от 11 сентября 1997 года
• Буриме от 11 ноября 1997 года

Запись фильма . Запись фильма в программе WinView/32 . Версия 2.2.1.10 . 1998, Princeton Instruments Inc . ... верхнее положение - синхронизирован с камерой . среднее положение - закрыт . нижнее положение - открыт . Настройки программы для записи фильма . Experimental Setup . ... Number of images (число кадров фильма) ? ... CCD readout use region of interest . Accumulation 1 . ... overwrite/append append to . 3) ROI setup . ... end, end x/4 . ...

Еще в разделе: (Показать все результаты (>29) - cellmotility.genebee.msu.ru/ )

. Click here to start INTAS 95-525 main page.

Еще в разделе: (Показать все результаты (>4) - composite.msu.ru/ )

• INTAS 95-525 Final Reprort (Short version)

About Department of Crystallography and Crystal Chemistry . Department of Crystallography and Crystal Chemistry was founded in Lomonosov Moscow State University by Correspoding Member of USSR Academy of Sciences Prof. G.B. Bokii in 1949. ... During all the time X-ray crystal structure determination of new minerals and their synthetic analogues remains the major part of scientific researches of the Department. ... Prof. N.N. Eremin), X-ray diffraction and crystal structure analysis (Prof. D.Yu. ...