... Statutes of ERC . Methodical Commissions of ERC . ... The Methodical Commissions of the MSU Nanotechnology Education and Research Center (ERC) are set up according to all the research specializations of ERC. The Methodical Commissions of ERC are collegial bodies that prepare education programs of ERC and programs for developing courseware and training materials. ... ERC participants may be mutually agreed with members of methodical commissions representing relevant faculties and chairs. ...

Еще в разделе: (Показать все результаты (>9) - nano.msu.ru/ )

Irena Lasiecka ( University of Virginia ) . Nikolai Melnikov (CEMI / MSU) . Mikhail Zelikin (MSU / Steklov Institute) . G. Avalos ( University of Nebraska , USA ) . V. Borisov (MSU, Moscow) . ... O. Emanouvilov ( Colorado State University , USA ) . A. Fursikov (MSU, Moscow) S. Hansen ( Iowa State University , USA ) R. Hildebrand ( Joseph Fourier University , France) V. Komornik ( University of Strassburg, France ) A. Kowalewski ( Institute of Automatics, Poland ) . ... Moscow) . ...

Еще в разделе: (Показать все результаты (>2) - oc.cs.msu.su/ )

... The characteristics of the materials we have selected, the procedure of winding the optic fibers and the coating process are described in detail. ... The `passive' inner cylinder, shown in the left part of the picture, was machined from an anticorodal aluminum rod while the conical part is used to lead the optic fibers from the coils down to the axis of the hydrophone. ... 6: The sensor after the coating process: the hydrophone (right) and the box --7-- containing the two fiber Bragg gratings. ...

Еще в разделе: (Показать все результаты (>12) - antares.sinp.msu.ru/ )

• ANTARES в МГУ

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>99) - www.genebee.msu.ru/ )

• BioSystems, 30 (1993) 57-63 57

HERMITE FUNCTIONS EXPANSION BASED NON-LOCAL MEANS ALGORITHM FOR CT-APPLICATIONS1 N. Mamaev2, A. Lukin3, D. Yurin4, M. Glazkova5, V. Sinitsin6 Laboratory of Mathematical Methods of Image Processing Faculty of Computational Mathematics and Cybernetics Lomonosov Moscow State University Leninskie Gory, Moscow 119991, Russia mamaev.nikolay93@mail.ru, 3lukin@ixbt.com, 4yurin@cs.msu.ru 5,6 Federal Center of Medicine and Rehabilitation Ivan'kovskoye sh., ... Noise in CT-images is close to Gaussian [3]. ...

Еще в разделе: (Показать все результаты (>8) - imaging.cs.msu.ru/ )

... Structure of Data . ... Catalog . ... The SAI OCL Catalog site provides several VO-enabled modes of operation: . VO-enabled catalog data analysis from a browser . ... Endpoint URL is http://ocl.sai.msu.ru/catalog/conesearch/ . ... VO-enabled catalog analysis from a browser . Presently, this recipe works with Firefox (Windows, MacOS, Linux), Internet Explorer (Windows) and Opera (Windows) browsers with Java plugin 1.6 installed. ... Main TOPCAT window with SAI OCL catalog loaded will appear. ...

Еще в разделе: (Показать все результаты (>2) - ocl.sai.msu.ru/ )

Lomonosov Moscow State University Biological faculty Botanical garden (Russia) (http://botsad.msu.ru/eng_news.htm) Botanical garden of the Komarov Botanical institute (Russia) Russian Iris Society Botanical garden of Taurida National Vernadsky University (Ukraine) The second information message Dear colleagues! ... Educational and enlightening activities based on collections of genus Iris L. The program of the Symposium will consist of plenary and sectional sessions as well as poster presentations. ...

Еще в разделе: (Показать все результаты (>7) - botsad.msu.ru/ )

• http://www.botsad.msu.ru/docs/eng_iris1.doc

International Scientific Workshop Oxide Materials for Electronic Engineering ­ fabrication, properties and application E-2009 Lviv ­ 2009 FIRST ANNOUNCEMENT Dear colleagues, We kindly invite you to take part in the International Scientific Workshop "Oxide Materials for Electronic Engineering ­ fabrication, properties and application" (-2009) that will be held in June 22­26, 2009 in Lviv Polytechnic National University (Lviv, Ukraine). ... Third circular (program announcement) .. ...

Еще в разделе: (Показать все результаты (>4160) - phys.msu.ru/ )

• New joint LG-Chem/MSU laboratory
• Физический факультет МГУ им. М. В. Ломоносова
• SAMSUNG JOB FAIR 2005

SAI, graduates year 1982. ... Note: when just a 7-digit phone number is shown, it refers to a phone located in Moscow (international access 007-495). "+" in front of a number means that you must dial an international access code first (or just press "+" on your mobile phone keypad). ... 939-1672(work); . ... Ataev Sasha . 1-(703)-536-8881(home) (USA); . ... Bychkov Sergey . ... 1-(410)-740-8205(home), +1-(301)-286-2150(work) (USA); . ... 1-(412)-767-0332(home), +1-(412)-608-9339(mobile) (USA); . ...

Еще в разделе: (Показать все результаты (>20) - uranus.sai.msu.ru/ )

Вы посетили: inv_engl.html . ... История кафедры . ... Visiting Professor at the University of Oslo, Norway, Oslo, November, 2010 . ... Visiting Professor at the University of Ljubljana, Slovenia, August, June 2010 . ... Visiting Professor at the University of Patras and the University of Athens, Greece, June-July 2009 . ... Visiting Professor at the University of Stockholm, Sweden, January ? ... staff/guterman/inv_engl.html.txt Последние изменения: 13.02.2013 11:26 (внешнее изменение) | ...

Еще в разделе: (Показать все результаты (>12) - halgebra.math.msu.su/ )

• staff:guterman:activ_rus.html | Кафедра высшей алгебры
• staff:guterman:conf_engl.html | Кафедра высшей алгебры
• staff:guterman:conf_rus.html | Кафедра высшей алгебры

... In this article we considerљcalculationљof discrete Laplacian for 1D arrays usingљpython/numpy/scipy. We introduceљthe sparse matrix technique that is rather efficient for computation of certain types of diffusion PDE. ... 1 комментарий " Constructing discrete Laplacian via sparse matrix " . Reaction-diffusion systems in 2D space with python ERG Research Group: Лаборатория теоретической биофизики написал (Январь 26th, 2016 2:13 пп) . ... Constructing discrete Laplacian via sparse matrix . ...

Еще в разделе: (Показать все результаты (>7) - erg.biophys.msu.ru/ )

• Reaction-diffusion systems in 2D space with python ERG Research Group:

... Ключевые слова: научно-церковная конференция ""Иисус Христос вчера и сегодня во веки Тот же": Христианство на пороге третьего тысячелетия" (Москва, 23-25 нояб. 1999 г.) ; история Русской Церкви (новейший период) . ... Журнал Московской Патриархии . ... 1 (ЖМП) . ... Ключевые слова: библиография, рецензии . ... Ключевые слова: библиография, рецензии ; библиотеки . ... Ключевые слова: библиография, рецензии ; Церкви Православные: Румынская ; периодика: "Румынская Православная Церковь" (Румыния) . ...

Еще в разделе: (Показать все результаты (>17) - www.srcc.msu.ru/ )

• http://www.srcc.msu.ru/bib_roc/bib/ItemsR29.htm

... June, 2005 . ... Moscow State University Russian Language Centre . Moscow State University . ... Learn Russian at the Moscow State University! Order of Legion of Honour . Victor Sadovnichy,the rector of the Moscow М.В. Lomonosov State University was awarded with the Order of Legion of Honour. (more.. ... Discover Russia with us! www.rlcentre.com . ... The first conference on preserving Russian language and Russian culture is to open in Gatesburg, Maryland. (more.. ...

Еще в разделе: (Показать все результаты (>10) - www.rlcentre.com/ )

... Alexander Konstantinov, music director . ... Olga Nazajkinskaja (soprano) . ... Aleksandr Konstantinov (violin) . Tatiana Andrianova (harpsichord) . ... Johann Sebastian BACH (1685 - 1750) . ... Suschevskaja str, 14 ('Novoslobodskaja' metro station) . ... 3 0 p.m. Central Restoration Workshops of Moscow Architectural Institute . ... 1685 - 1750) . ... 0 0 p.m. M.V. Lomonosov Moscow State University . ... Moscow State University, the Main building at Vorob'evy Gory (' University ' metro station) . ...

Еще в разделе: (Показать все результаты (>24) - music.genebee.msu.ru/ )

. The work is supported by the Russian Foundation for Basic Research, grant 10-07-00685-a . Up . You are here . Class . Alpha and beta proteins (a/b) . Fold . Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) . Superfamily . L domain-like . Family . U2A'-like . protein domain . species . PDB code . Instances . Bonded . Splicesomal U2A' protein . Human (Homo sapiens) [TaxId: 9606] . 1a9n . 2 . 2 . Total - 1 entries shown . 1 . 2 . 2 . Ask a question about this service: sas@belozersky.msu.ru .

Еще в разделе: (Показать все результаты (>75) - monkey.belozersky.msu.ru/ )

... Флогистон / Психологические форумы / Психологический форум на "Флогистоне". / тест на подверженность авторитарному влиянию RAW (1550 просмотра) . ... Написано: 2009-03-31 09:58 . ... Но поскольку сам я любитель и тема меня интересует отнюдь не как профессионала - хочется узнать мнение психологов по поводу корректности таких тестов. ... На мой взгляд, не будет в российских реалиях работать, поскольку большинство тех, кто себя к православным относит, церковь посещают нерегулярно. и вопрос: . ...

Еще в разделе: (Показать все результаты (>43) - www.flogiston.ru/ )

... Surface disturbance and deformat ion are shown in the same scale. Displac the free surface is much smoother as compared bottom deformations: init ial elevat ion has amplitude and spreads over a rather wide area. bottom theory, bottom ement of with the smaller F ­ velocity potential, H ­ depth, ­ vector of bottom deformation, 0 ­ initial elevation a . ... The init ial elevation assumed to be equal to the vertical bottom deformat ion (a); calculated with use of the Laplace smoothing algorithm (b). ...

Еще в разделе: (Показать все результаты (>12) - ocean.phys.msu.ru/ )

• http://ocean.phys.msu.ru/courses/geo/lectures-addons/02/2006%20Wood%20et%20al.%2C%20Accretion%20of%20the%20Earth%20and%20segregation%20of%20its%20core.pdf

\oddsidemargin=-0.02 true cm \evensidemargin=-0.02 true cm \textheight=23.5 true cm %\renewcommand{\baselinestretch}{1.33} \chardef\no=194 \ def \epsilon{\ze} %---------------------------------------------------------------------- \ def \subtitle#1{\begin{center} \bf #1 \end{center} \nopagebreak } %---------------------------------------------------------------------- \ def \trmatr#1#2#3{\left(\matrix{ #1 #2 {} {} {} {} {} {}\ ... 1) Пусть $q_1=q_2$, т.е. $|d|=2\,|c|$. ...

Еще в разделе: (Показать все результаты (>22) - num-anal.srcc.msu.ru/ )

• Причастные обороты

First Russian Conference . ... 7-9 June 2005, Moscow . ... Application of ozone in ecology . ... 20 January 2005 - mailing of the 2 nd information letter . ... The Conference is targeting to provide Russian specialists with the information about modern oxidative and inactivative ozone technologies using ozone as an unique disinfectant. ... In view of the Conference will be held in June, 2005, the regular 28th Workshop on Ozone and other environment friendly oxidants is postponed till December, 2005. ...

Еще в разделе: (Показать все результаты (>21) - www.kge.msu.ru/ )

• Дипломные работы

... Master . Master net Homepage . ... Seminar archive . ... Seminar archive 1997 13 June . ... Липунова Г. В. ( ГАИШ МГУ ) . Панченко И. Е. ( ГАИШ МГУ ) . Липунов В. М. ( МГУ, ГАИШ МГУ ) . ... 20 min. ... All seminars: . ...

Еще в разделе: (Показать все результаты (>19) - master.sai.msu.ru/ )

• YaB-100 conferences