... about ERC . education . research . events . ... Being an effective way of acquiring knowledge, they also make a good addition to core lecture courses and involve students, postgraduates and scientists of other Russian higher education institutions and research centers in ERC activity in the initial stage. ... More information can be found at http://polly.phys.msu.ru/ru/unc/sconf.html . ... Conference on Development Prospects of Education and Research Centers in the Russian Federation . ...

Еще в разделе: (Показать все результаты (>22) - nano.msu.ru/ )

• Fundamentals of Nanotechnology, 2009 | MSU Nanotechnology Education and
• Fundamentals of Nanotechnology, 2009 | Научно-образовательный центр по
• MSU Nanotechnology Education and Research Center. Mission. | MSU Nanotechnology

... Outflows, proceeding during decades result to formation of oil secondary deposits. In a near-surface zone, oil pollution becomes especially chemically active and reacts with geological environment, that results in the anomalies of various geophysical methods: SP, IP, GPR and resistivity. ... The DAS, AM AMN algorithm of median polishing was offered by J.W.Tukey (1981), Rmin ABmin and after modification made by E.V.Pervago was applied for proc5 essing of Total Electrical Sounding (TES) data. ...

Еще в разделе: (Показать все результаты (>72) - geophys.geol.msu.ru/ )

• http://geophys.geol.msu.ru/shevnin/publ/149.pdf
• http://geophys.geol.msu.ru/gravity.htm
• TES. Modeling example.

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>11) - storage.bioinf.fbb.msu.ru/ )

The Converter of Measurement Units is aimed to converting of measurement units between different systems of measurement, for example from British-American units of measurement to metric system and vice versa. To convert a value . ... On the left panel list select a measure you want to convert . ... Select the measurement unit you want to convert from . ... Select the measurement unit you want to convert to . ... Result is displayed in the "Conversion Result" area. ...

Еще в разделе: (Показать все результаты (>17) - sbmg.geol.msu.ru/ )

... 8 DOI: 10.1093/nar/gkh583 Mapping of the second tetracycline binding site on the ribosomal small subunit of E.coli Maria M. Anokhina1, Andrea Barta2, Knud H. Nierhaus3, Vera A. Spiridonova4 and Alexei M. Kopylov1,4,* Department of Chemistry ... University, 119992 Moscow, Russian Federation Received February 5, 2004; Revised March 22, 2004; Accepted April 14, 2004 1 ABSTRACT Tetracycline blocks stable binding of aminoacyltRNA to the bacterial ...

Еще в разделе: (Показать все результаты (>6) - rnp-group.genebee.msu.ru/ )

• http://rnp-group.genebee.msu.su/pdfs/article_vas_bioelectro.pdf
• http://rnp-group.genebee.msu.ru/pages/pdf/biochem2003.pdf
• http://rnp-group.genebee.msu.su/pdfs/MolBio6_00KopylovLO.pdf

Nanoterrorism: New Responsibility for Our World and Future in the Global TechnoScience Vitaly G. Gorokhov Institute for Philosophy of the Russian Academy of Sciences, Institute of Technology Assessment and Systems Analysis of the Research Center Karlsruhe (Germany) Vitaly.Grorokhov@itas.fzk.de "Bioterrorism and chemical warfare are not unthinkable. ... 2] But these conditions do not else exist for the time being in nanoscience and nanotechnology. ...

Еще в разделе: (Показать все результаты (>11) - iisi.msu.ru/ )

• http://www.iisi.msu.ru/UserFiles/File/bayern2009/twomey.doc

Review articles SINE insertions: powerful tools for molecular systematics Andrew M. Shedlock 1,2 and Norihiro Okada1* Summary Short interspersed repetitive elements, or SINEs, are tRNA-derived retroposons that are dispersed throughout eukaryotic genomes and can be present in well over 104 total copies. ... 2A), only one or perhaps a few highly active "master" SINE loci are capable of amplification, giving rise only to non-propogating offspring copies. ... 4) Independence of SINE insertions. ...

Еще в разделе: (Показать все результаты (>63) - vertebrata.bio.msu.ru/ )

• Student Reports at International Conferences
• Выступления студентов и аспирантов на конференциях

... Kornev, V., Sharafiev, A., Kolotinskiy, N., and Mukhanov, O. Microwave dynamics of superconducting quantum cell.љ ... DOI љ] . ... Kornev, V., Sharafiev, A., Soloviev, I., and Mukhanov, O. Signal and noise characteristics of bi-squid.љ ... Kornev, V., Sharafiev, A., Soloviev, I., Kolotinskiy, N., Skripka, V., and Mukhanov, O. Superconducting quantum arrays.љ ... Kornev, V., Sharafiev, A., Soloviev, I., Kolotinskiy, N., and Mukhanov, O. Superconducting quantum arrays for broadband rf systems.љ ...

Еще в разделе: (Показать все результаты (>6) - cryolab.phys.msu.ru/ )

• Publications (from 2011)
• Victor K. Kornev

... About lab . ... For Students . ... Online Journal "Computer graphics and multimedia" (in russian) . ... Online Random Forest for Interactive Image Segmentation . ... In many cases one needs to obtain accurate segment maps for a large dataset of images that depict objects of certain semantic categories. ... In this work we present an online learning framework for interactive semantic image segmentation that simplifies processing of such image datasets. ...

Еще в разделе: (Показать все результаты (>260) - graphics.cs.msu.ru/ )

• Automatic Binary Segmentation of Moving Objects in Video | Graphics and Media
• Road monitoring | Graphics and Media Lab
• Automatic Binary Segmentation of Moving Objects in Video | Лаборатория

ISSN 1560-3547, Regular and Chaotic Dynamics, 2015, Vol. ... 6 2015 SEQUENTIAL DYNAMICS IN THE MOTIF OF EXCITATORY COUPLED ELEMENTS 703 Then the system under study equation): 1 = = 2 3 = takes the following form (we deleted two multipliers from every (F (2 )+ F (3 ))1 (-1+2F (3 ) - 1 2 ), (F (3 )+ F (1 ))2 (-1+2F (1 ) - 2 2 ), (F (1 )+ F (2 ))3 (-1+2F (2 ) - 3 2 ). ... Vol. ... 6 2015 SEQUENTIAL DYNAMICS IN THE MOTIF OF EXCITATORY COUPLED ELEMENTS 709 function, the system takes the form (4.2). ...

Еще в разделе: (Показать все результаты (>118) - ics.org.ru/ )

• http://ics.org.ru/upload/iblock/94a/borisov2011.pdf
• http://ics.org.ru/upload/iblock/d42/1511.02655v1.pdf
• http://ics.org.ru/upload/iblock/268/pu_58_1220.pdf

... Statistics One, Lecture 3, example script # Read data, plots histograms, get descriptives library("psych") ratings . Statistics One, Assignment One Statistics 1, Assignment 2 . ... Дайджест психологических исследований . ЖЖ-сообщество ?RU_SPSS? ... Сервер виртуальных исследований . Скачать SPSS . Статистика блога . ... R-советы: Экономим время и место на диске путем сжатия файла данных . ... Yurij Tukachev on Twitter Counter Вам нравятся материалы блога? ...

Еще в разделе: (Показать все результаты (>13) - tukachev.flogiston.ru/ )

• Category: Новости

О лаборатории . ... Лаборатория теоретической биофизики . ... The manual to FireFly program clearly explain why and how to use spherical or cartesian functions when working with different basis sets. ... The $D5 group provides further control through the D5, F7, and G9 keywords, which pertain to d, f, and g functions, respectively. ... Quantum chemistry information page ERG Research Group: Лаборатория теоретической биофизики написал (Май 19th, 2015 5:52 пп) . ... 2014 ERG Research Group . ...

Еще в разделе: (Показать все результаты (>57) - erg.biophys.msu.ru/ )

• OPLS-AA patch for different types of molecules ERG Research Group: Лаборатория
• comcon1 ERG Research Group: Лаборатория теоретической биофизики
• Gaussian Cube files loader ERG Research Group: Лаборатория теоретической

... Математический семинар глобус, заседание 26 апреля 2005 г. Во вторник, 26 апреля 2005 года, в 15:40 в конференц-зале НМУ, Б. Власьевский, 11 состоится доклад Games in computer science: a survey . ... In this talk, we shall survey different uses of games in computer science, which split roughly along issues of provability versus proofs. ... As for proofs , the emphasis is on the dynamics of strategies. Here, strategies are just another way of looking at proofs / programs / morphisms. ...

Еще в разделе: (Показать все результаты (>113) - www.mmonline.ru/ )

• MMOnline | Форумы | Аспирантура | PhD position in the University of Florida
• MMOnline | Новости | Математический семинар глобус, заседание 26 апреля 2005 г.

Dynamo Theory and Earth's Magnetic Field Paul Demorest May 21, 2001 1 Intro duction The Earth's magnetic field belongs in that class of physical phenomena which are commonplace yet also very complex. ... 3 Single Disc Dynamo Before we dive into the mess of equations and approximations that describe how fluid motion and magnetic field interact, it is useful to demonstrate a very simple system which exhibits dynamo action. ... A system without fluid motion cannot support a magnetic field indefinitely. ...

Еще в разделе: (Показать все результаты (>16) - ocean.phys.msu.ru/ )

• http://ocean.phys.msu.ru/courses/stathyd/2001%20Ferrari%20et%20al.%2C%20The%20temperature-salinity%20relationship%20of%20the%20mixed%20layer.pdf

Contemporary media environment is formed by dense concentration and interaction of cultures, languages, channels and modalities of communication. ... Across this new terrain, rich, exciting and risky, the new generation of media practitioners, teachers, researchers and public intellectuals is expected to navigate competently and creatively. ... Nor can the idea of intercultural communication be limited (as it was тАУ only recently) to relatively formal contact between established national cultures. ...

Еще в разделе: (Показать все результаты (>7) - discours.philol.msu.ru/ )

... Advanced chapters of operation research . Algebraic characterization of basic solution of linear program. ... Advanced chapters of Actuarial Mathematics . ... Discounted cash flow analysis and capital budgeting as decision tools are given particular emphasis. ... In the first part of the course we present a modern approach to modeling economic systems. ... The problem of tax optimization under a given financing budget. ... Магистратура: master@cmc.msu.ru, 3-й этаж, комната 360, тел. ...

Еще в разделе: (Показать все результаты (>9) - hcs.cmc.msu.ru/ )

HERMITE FUNCTIONS EXPANSION BASED NON-LOCAL MEANS ALGORITHM FOR CT-APPLICATIONS1 N. Mamaev2, A. Lukin3, D. Yurin4, M. Glazkova5, V. Sinitsin6 Laboratory of Mathematical Methods of Image Processing Faculty of Computational Mathematics and Cybernetics Lomonosov Moscow State University Leninskie Gory, Moscow 119991, Russia mamaev.nikolay93@mail.ru, 3lukin@ixbt.com, 4yurin@cs.msu.ru 5,6 Federal Center of Medicine and Rehabilitation Ivan'kovskoye sh., ... Noise in CT-images is close to Gaussian [3]. ...

Еще в разделе: (Показать все результаты (>12) - imaging.cs.msu.ru/ )

• http://imaging.cs.msu.ru/files/courses/ipintro2012/Lec_Pt3_inpaint_my.pdf
• http://imaging.cs.msu.ru/pub/2013.PRIA.Levashov_Yurin.RidgeAndTree.en.pdf

... L Сd , Pol a nd ABOUT EFFECTIVE MODES METHOD FOR DESCRIPTION OF INTERNAL DYNAMICS OF WEAKLY BOUND CLUSTERS Elena Belega, Evgeny Cheremukhin 1 , Dmitry Trubnikov Abstract: New approach to describe the internal dynamics of weakly bound clusters is presented. ... It is found that the number of active collective modes depends on the initial cluster excitation and that the internal energy is partitioned nonuniformly among the modes. ... Collective motion of oxygen atoms performs mostly in plane. ...

Еще в разделе: (Показать все результаты (>18) - beams.chem.msu.ru/ )

• Сверхзвуковые струи - Лаборатория молекулярных пучков МГУ

LOCAL TSUNAMI WARNING AND MITIGATION ________________________________________________________________________________________________________________________________________ WHAT EVIDENCE EXISTS FOR PALEOTSUNAMI TRIGGERED BY LOCAL EARTHQUAKES IN THE WELLINGTON REGION OF NEW ZEALAND? ... Recently a study was carried out to document evidence for large earthquakes in the Holocene sedimentary record of the Wellington region of New Zealand [Cochran, 2002]. ... T ECTONIC SETTING New Zealand lies (Figure 1). ...

Еще в разделе: (Показать все результаты (>25) - seac47-2.phys.msu.ru/ )

• http://seac47-2.phys.msu.ru/proc/E01_Armigliato.pdf
• http://seac47-2.phys.msu.ru/proc/E12_Marchuk.pdf
• LOCAL TSUNAMI WARNING AND MITIGATION -- Proceedings Download Page

... On-line консультант . ... Анонсы Online семинары . ... Семинар состоится 22.07.2010 в 16.00 . ... Семинар состоится 12.08 в 16.00 . ... Получить подробную информацию о семинарах и зарегистрироваться Вы можете на сайте . ... Copyright ВМиК МГУ , 2008 . ...

Еще в разделе: (Показать все результаты (>4) - erp.cmc.msu.ru/ )