A standard application form is available on the MSU site . ... The original document confirming the obtained level of education, indicating the qualification (or degree) and supplemented by the list of the undertaken courses and the received marks. ... A valid health certificate (Form 0.86) allowing the bearer to study in the Russian Federation, and at the History Faculty in particular (to be received in the MSU clinic № 222, upon the official request from the Faculty's International Office). ...

Еще в разделе: (Показать все результаты (>6433) - hist.msu.ru/ )

• Moscow State University. Faculty of History. Frequently Asked Questions
• The Educational
• Volodin Andrei

... NetCDF User's Guide for C . Unidata ( http://www.unidata.ucar.edu ) is a National Science Foundation-sponsored program empowering U.S. universities, through innovative applications of computers and networks, to make the best use of atmospheric and related data for enhancing education and research. ... The Network Common Data Form (netCDF) software described in this guide was originally intended to provide a common data access method for the various Unidata applications. ...

Еще в разделе: (Показать все результаты (>51) - angel.cs.msu.su/ )

• PhD Summer School on Scentific Computing
• : Class IndexIterator
• : Class Attribute

Заседание семинара по социофизике . ... Goubko M. (2014) Minimizing Degree-Based Topological Indices for Trees with Given Number of Pendent Vertices // MATCH Commun. ... Goubko M., Gutman I. (2014) Degree-based topological indices: Optimal trees with given number of pendents // Applied Mathematics and Computation. ... Goubko M., Reti T. (2014) Note on Minimizing Degree-Based Topological Indices of Trees with Given Number of Pendent Vertices // MATCH Commun. ...

Еще в разделе: (Показать все результаты (>8) - www.soc-phys.chem.msu.ru/ )

... Выпускники . ... Канада (+США) . ... Женский клуб . ... Издательство МГУ . ... Выпускники МГУ . ... Дайв-Клуб МГУ . ... The J. Franklin Jameson Fellowship (стипендии молодым кандидатам наук) . 05.12.2004 . ... В исследовательском проекте стипендиата должна быть убедительно доказана необходимость использовать коллекцию Библиотеки для выполнения данного исследования. ... В 2003/2004 гг стипендия - $5,000. ... Крайний срок подачи заявок для участия в конкурсе стипендий - 31 декабря 2004 года. ...

Еще в разделе: (Показать все результаты (>489) - www.moscowuniversityclub.ru/ )

• Клуб выпускников МГУ: Senior International Fellows Program
• Клуб выпускников МГУ: IN VITRO ВЛИЯНИЕ ОПЕРАТОРА ЦИГУН НА ИЗМЕНЕНИЕ
• Клуб выпускников МГУ: Конференция "Выпускники ВМиК"

... Rod unfortunately was not able to come to Garmisch this year, but has been in touch with the Russian Internet community in Seoul, Sharm el Sheikh, Nairobi, and the United States, and has sent a special letter to Vladislav Petrovich. ... ICANN is working with regional associations and the Internet Society in a global training program that is raising the security awareness and skills of those DNS operators in regions where resources for such training are limited. ...

Еще в разделе: (Показать все результаты (>6) - www.iisi.msu.ru/ )

... References . ... References to books should include the author's name; year of publication; title; page numbers where appropriate; publisher; place of publication, in the order given in the example below. ... Ramirez, F. J., Marquez, R. A. C., and Mondaca, G.: 1991, The 1877 great tsunami and the rapid local warning network in the coast of Northern Chile - South America, In: Proc. International Conference of Australian Earthquake Engineering Society , Brisbane, Australia, 25-1. ... Information . ...

Еще в разделе: (Показать все результаты (>24) - seac47-2.phys.msu.ru/ )

... CUDA Center of Excellence | MSU . ... Lomonosov Moscow State University (MSU) was awarded an NVIDIA CUDA Center of Excellence (CCOE) in 2011 for being one of the first Russian universities to recognize the importance of emerging GPU technologies and first to embrace CUDA. ... Lomonosov Moscow State University (MSU) is renowned as one of the leading computer science centers excelling in application of computational resources to address most vital scientific problems. ...

Еще в разделе: (Показать все результаты (>7) - ccoe.msu.ru/ )

. Metatech Corporation . Applied Power Solutions Division . SpaceCast/PowerCast ™ . Space Weather Forecasting Services

Еще в разделе: (Показать все результаты (>197) - www.kosmofizika.ru/ )

• Menu Bar

Evgeny V. Antipov . ... Selected original papers . ... Synthesis, structure and superconducting/magnetic properties of Cu- and Mn-based oxyfluorides / E.V. Antipov and A.M. Abakumov// Functionalized Inorganic Fluorides (edited by Alain Tressaud), -2010. ... Advanced electron microscopy and its possibilities to solve complex structures: application to transition metal oxides / Gustaaf Van Tendeloo, Joke Hadermann, Artem M. Abakumov and Evgeny V. Antipov /// JOURNAL OF MATERIALS CHEMISTRY. ... 2008. ...

Еще в разделе: (Показать все результаты (>103) - electr003.chem.msu.ru/ )

• Evgeny V. Antipov:CV
• Veronika K. Laurinavichute: Selected Publications

Preliminary The first circular The First International Symposium SPACE EDUCATION and UNIVERSITY SATELLITES (UNIVERSAT- 2006 ) June 26 -30, 2006 Moscow , Russian Federation FIRST ANNOUNCEMENT The Organizing Co mmittee cordially invites you to take part in The First International Symposium on Space Education and University Satellites (UNIVERSAT- 2006 ) which will be held in ... The key topics are listed below within the session : I. Space Sciences University Education 1. ...

Еще в разделе: (Показать все результаты (>6708) - cosmos.msu.ru/ )

• University Satellites and Space Science Education '2006

AliComp - GeneBee Alignment Comparison Help Type in a title for this session for you to remember. ... First alignment: .* ... HCVPCP2 ( 279) LLSVTSVVM------VGGYVAPVNTVKPKPVINQ TGVPCP2 ( 277) AIASNFVVKK-PQAEERPKNCAFNKVAASPKIVQ MHVPCP2 ( 288) CLYLKNLKQTFSSVLTTFYLDDVKCVEYKPDLSQ MHVPCP1 ( 272) GYGMTFSMSPFELAQLYGSCITPNVCFVK----- HCVPCP1 ( 262) TICIKDADY---NAKVEISVTPIKN--------- TGVPCP1 ( 256) TLFINANVM--TRAEKPKQEFKVEKVEQQPIVEE IBVPCP ( 282) AMYTRFAFK----NETSLPVAKQSKGKSKS-VKE Second alignment : ...

Еще в разделе: (Показать все результаты (>222) - www.genebee.msu.ru/ )

• AliGraf - GeneBee Graphical Alignment Help
• Screening by similarity
• razjivin_dept

http://hcch.e- vision.nl/index_en.php?act=conventions.status cid=41 на 05-02-2009 [pic] Last update: Number of Contracting States to this Convention: 95 [pic] 1) S = Signature 2) R/A = Ratification or Accession 3) Type = R: Ratification; A: Accession ; A*: Accession giving rise to an acceptance procedure; click on A* for details of acceptances of the ... 1 |D13 | ... Austria |5-X-19|14-XI-|R |13-I-1| ... Su |24-I-1| ... 965 | ... China, People's Republic| ... 1999 | ... 006 |006 | ... 006 | ...

Еще в разделе: (Показать все результаты (>18) - iisi.msu.ru/ )

• http://www.iisi.msu.ru/UserFiles/File/bayern2009/twomey.doc

Core information (Nucleus, Levels, Gamma transition, Decays, Data type) . ... any adopted (levels and gammas only) experimental . ... Query parameters: . Select for output . ... Levels (E, JPI, T1/2, etc.) ... Energy (keV) . ... Y D H M S MS US NS PS FS AS EV KEV MEV or Stable . ... Energy of the ?-ray (keV) . Relative photon intensity . ... Energy parameters of nucleus (B , Alpha energy, N, P separation energy) . ... Neutron separation energy (keV) . Proton separation energy (keV) . ...

Еще в разделе: (Показать все результаты (>3) - depni.sinp.msu.ru/ )

Nuclear Instruments and Methods in Physics Research B 206 (2003) 842­845 www.elsevier.com/locate/nimb Modeling of surface smoothing process by cluster ion beam irradiation A. Nakai c a,* , a T. Aoki a,b , T. Seki a,b , J. Matsuo a, G.H. Takaoka a, I. Yamada b,c Ion Beam Engineering Experimental Laboratory, Kyoto University, Sakyo, Kyoto 606-8501, Japan b Collaborative Research Center for Cluster Ion ... Smoothing rate depends on the wave number as well as the ion dose. ...

Еще в разделе: (Показать все результаты (>125) - danp.sinp.msu.ru/ )

• http://danp.sinp.msu.ru/ACS_pdf/atcol_1.pdf
• http://danp.sinp.msu.ru/Articles_GSIB/nimb_Ar_clasterionbeam.pdf
• http://danp.sinp.msu.ru/Articles_GSIB/nimb206_861_clasterionsize_Yamada.pdf

Call Title: Call for proposals for ERC Starting Independent Researcher Grant Call identifier: ERC -2012-StG Date of publication: 20 July 2011 Electronic proposal submission deadlines1 (single submission of full proposal): 2 Domain Physical Sciences Engineering (Panels PE1 - PE10): 12 October 2011, 17.00.00 (Brussels local time) Domain Life Sciences (Panels LS1 ­ LS9): 9 November 2011 17.00.00 (Brussels local time) Domain Social ... See section 4.6 and Annex 9 of the work programme. ...

Еще в разделе: (Показать все результаты (>37) - ideas.msu.ru/ )

• http://www.msu.ru/int/newpr/7ram/7ram_budz.pdf
• http://ideas.msu.ru/docs/AdG_call_2010.pdf
• http://ideas.msu.ru/docs/call_SyG_2012.pdf

... справочник учебные материалы ссылки программы . ... 5. a number-the number . ... фотоs учебные материалы : выберите дисциплину неорганическая химия аналитическая химия органическая химия химические основы биологических процессов физическая химия квантовая механика, химия и строение молекул радиохимия кристаллохимия коллоидная химия химия ВМС химическая технология история и методология химии ------------------------------------------------- математический анализ теория ...

Еще в разделе: (Показать все результаты (>6) - www.students.chemport.ru/ )

• Список слов, необходимых для сдачи экзамена по английскому

Martes martes . Specific functional forms of behavior in pine marten Martes martes , based on snow tracking data . ... The paper describes the main functional forms of pine martenв?T Martes martes behavior which include leaving refuge, foraging, change of feeding area, patrolling their territory, locomotion to resting site, rest, and running for safety. ... The hierarchy of reactions in mammals is illustrated for the pine marten. ... Human impact changes the structure of behavior in pine martens. ...

Еще в разделе: (Показать все результаты (>1365) - zmmu.msu.ru/ )

• National bat report
• Russian Journal of Theriology