... Alexander A. Moskovsky . ... Software Designer : . ... Projects: . Janitor II, Custodian III for Matrix Logic - utilities for DOCS Open EDMS (electronic document management system), C++/Win32 platform. ~2 man-year project with 5 persons team. iBuzz - (for ibuzz.com ) large client-server system (Win32, Enterprize Java Beans, Oracle, Sun/Solaris). ... Lunch Ordering Web System. ... Software Resources International , former Digital Moscow Software Center, . ... Physical Chemistry chair, . ...

Еще в разделе: (Показать все результаты (>11) - lcc.chem.msu.ru/ )

TOHOKU UNIVERSITY SCIENCE SUMMER PROGRAM 2016 July 4th to July 15th, 2016 What's TSSP? ... It aims to provide students with insight on what world society needs based on advanced science and technology in the future and how they can contribute to society. ... Students will also have many opportunities to interact with Tohoku University students. ... PROGRAM SCHEDULE [TSSP]: Monday 4th July, 2016 to Friday 15th July, 2016 Applying for two consecutive terms (ex. TSSP and TUJP-2) is not allowed. ...

Еще в разделе: (Показать все результаты (>76) - phys.msu.ru/ )

• http://phys.msu.su/rus/about/structure/admin/EPFL.doc
• http://phys.msu.su/upload/iblock/63a/ic-cmtp3%20First%20Circular1-2.pdf

... Two horseradish peroxidase C (HRPC) mutants with substitutions in the active center, i.e., Phe41-->His and Phe143-->Glu, were compared to the wild-type recombinant enzyme expressed in Escherichia coli in terms of the enzymatic activity and stability under irradiation. ... The radiolytic inactivation of the wild-type and mutant forms of recombinant HRP suggested different binding sites for iodide, 2,2'-bis(3-ethylbenzothiasoline-6-sulfonate (ABTS), guaiacol, and O-phenylene diamine. ...

Еще в разделе: (Показать все результаты (>100) - www.enzyme.chem.msu.ru/ )

• Entrez-PubMed

... The Symposium's three breakout sessions focused on risks from different perspectives: enterprise use, resource constrained environments, and combating malicious use. ... Specifically, a DNS collaborative response, awareness, technical training, and future DNS security, stability, and resiliency collaboration should take precedence within the issues selected for further study and implementation. ... Breakout Session Overview.. ... 30 Appendix F: Combating Malicious Use Breakout Session Guide Book .. ...

Еще в разделе: (Показать все результаты (>17) - iisi.msu.ru/ )

• http://www.iisi.msu.ru/UserFiles/File/Terminology%20IISI%20EWI/Russia-U%20S%20%20bilateral%20on%20terminology.pdf
• http://www.iisi.msu.ru/UserFiles/File/bayern2016/InfoMessageEng2.pdf
• http://www.iisi.msu.ru/UserFiles/File/nostr/d_3-3.doc

DAYS on DIFFRACTION' 2011 1 Derivation of mo dified Smyshlyaev's formulae using integral transform of Kontorovich-Leb edev type Valery Yu. ... Mo dified Smyshlyaev's formulae represent the same directivity as a single contour integral over parameter . ... He has obtained the following formula There are embedding formulae of two sorts: for the diffraction coefficient: f ( , 0 ) = i e- i as a limiting case of Green's function g as the source location approaches edge of the scatterer. ...

Еще в разделе: (Показать все результаты (>42) - acoustics.phys.msu.ru/ )

• http://acoustics.phys.msu.su/teachers/shanin_files/~shanin/papers/shwaan1.pdf
• http://acoustics.phys.msu.su/teachers/gusev_files/nano2.pdf
• http://acoustics.phys.msu.su/teachers/shanin_files/~shanin/papers/weinstein2_eng.pdf

... Notation of symbols used; Bold, italic, roman... 3 te 1 MB = Member body (enter the ISO 3166 two-letter country code, e.g. CN for China; comments from the ISO/CS editing unit are identified by **) 2 Type of comment: ge = general te = technical ed = editorial NOTE Columns 1, 2, 4, 5 are compulsory. page 1 of 5 ISO electronic balloting commenting template/version 2001-10 Template for comments and secretariat observations 1 MB1 2 Clause No./ ... CLOSED: Not accepted BE Be 4.2.2 ed Corrected to "events"...

Еще в разделе: (Показать все результаты (>8) - srd.sinp.msu.ru/ )

• http://srd.sinp.msu.ru/nymmik/models/bazilevskaya_2.pdf
• http://srd.sinp.msu.ru/nymmik/models/bazilevskaya_1.pdf

... The following diets will be discussed: . ... michael kors outlet uk . ... 2016 С Днем Победы! ... win 7 ultimate product key Windows 8 key windows 7 key win 7 key windows 7 pro product key win 7 pro product key windows 7 activation key windows 7 ultimate product key windows 7 ultimate serial key windows 7 key online win 7 ultimate key win 7 serial keys Win 7 ultimate key Win 7 ultimate product key windows 7 key sale win 7 ultimate product Key ...

Еще в разделе: (Показать все результаты (>98) - elana.sinp.msu.ru/ )

• cheap moncler developed by examiners through their skills and expertise | С
• . This is really a loud piece so you want to keep all you wear with it super
• questo tessuto sar? presente fatto grande differenza tra vivere e morire | С

... Rapid developments of lasers and particle accelerators resulted in implementation of laser plasma X-ray sources and free electron lasers for various experiments requiring high intensity, shrt duration and monochromatic X-ray radiation. ... BASICS AND APPROACH Thirty years development of laboratory X-ray lasers allowed to reach ~0.1 keV photon energy of coherent X-ray beams in a repetitive mode. ... X-rays originate from Thomson scattering of counter propagating laser and electron beams. ...

Еще в разделе: (Показать все результаты (>6) - miles.sinp.msu.ru/ )

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>10) - storage.bioinf.fbb.msu.ru/ )

... About hotel . Services . ... The hotel ?69th Parallel? is glad to present its renewed website which now has an option of online booking! Feel free to share your opinion about us .. Hotel "69 Parallel" offers its guests meeting room for meetings, seminars and presentations. ... The cost of the lease without the use of equipment is 200 rubles for one hour. ... Order: (8152) 253-700, reserv@69parallel.ru . ... The hotel "69 Parallel" gives you the following list of services: . ...

Еще в разделе: (Показать все результаты (>22) - 69parallel.ru/ )

This document contains frames

Еще в разделе: (Показать все результаты (>23) - shg.phys.msu.ru/ )

... What is the author's opinion on the problem? ... Organize the following parameters into 3 groups: content, organization, presentation (performance) · Body-language and eye contact · Fluency · Proper intonation and pronunciation · Relevant information and examples provided · Conclusion · Key concepts explained\defined · A range of complex grammatical structures and academic vocabulary · Key points emphasized · Introduction · Various linking devices, the transition from one point to the ...

Еще в разделе: (Показать все результаты (>20) - www.eng.math.msu.su/ )

• http://www.eng.math.msu.su/download/Academic_English_part1.pdf
• http://www.eng.math.msu.su/download/Academic_English_part2.pdf
• http://www.eng.math.msu.su/download/Midterm_test.pdf

... Revision Log Mode: Stop on copy Follow copies Show only adds and deletes View log starting at and back to . ... edit) . ... 5 years . me.dendik . ... Added rule to evade trapping yourself while eating for e4 snake . ... Added "run mostly forward" rule to e2 snake . ... Changed display names in e2, e4 snakes (they were both Example тАж . ... e4 snake now tries to zig-zag . ... Added two smarter snakes: e2 and e4 . ... snakes added . ... Added example empty snake . ... Added example snake . ...

Еще в разделе: (Показать все результаты (>416) - kodomo.cmm.msu.su/ )

• Custom Query в?' Cyclyc Cell Automata
• Custom Query ? Cyclyc Cell Automata

I NSTITUTE OF PHYSICS PUBLISHING PHYSICAL B IOLOGY Phys. Biol. 3 (2006) 121­129 doi:10.1088/1478-3975/3/2/004 Direct simulation of plastocyanin and cytochrome f interactions in solution I B Kovalenko1,AMAbaturova1, P A Gromov2,DMUstinin1, E A Grachev2, G Yu Riznichenko1 and ABRubin1 1 2 ... 2006 Online at stacks.iop.org/PhysBio/3/121 Abstract Most biological functions, including photosynthetic activity, are mediated by protein interactions ... We use this structure in our simulation. ...

Еще в разделе: (Показать все результаты (>37) - library.biophys.msu.ru/ )

• http://library.biophys.msu.ru/PDF/3336.pdf
• http://library.biophys.msu.ru/PDF/3343.pdf
• http://library.biophys.msu.ru/PDF/3335.pdf

THE JOURNAL OF CHEMICAL PHYSICS 136, 034902 ( 2012 ) Electrostatic interaction of neutral semi-permeable membranes Olga I. Vinogradova,1,2 , and Vladimir Lobaskin6 1 a) Lyderic Bocquet,3 Ar tem N. Bogdanov,1 Roumen Tsekov,4,5 A. N. Frumkin Institute ... This gives rise to a distance-dependent membrane potential, which translates into a repulsive electrostatic disjoining pressure. ... Phys. 136, 034902 (2012) interacting semi-permeable membranes. ... The membranes are located at |x| = h/2. ...

Еще в разделе: (Показать все результаты (>29) - nanofluidics.phys.msu.ru/ )

• http://nanofluidics.phys.msu.ru/paper/pre2012_1.pdf
• http://nanofluidics.phys.msu.ru/paper/jpcm2011.pdf
• http://nanofluidics.phys.msu.ru/paper/jcis3.pdf

... Пользователи -General- Common Current University Society Study Diaspora FAQ Real Estate -Technical- Development Hard&Soft Network Mobile -Market- Market Services Job -Hobby- Behemoth Health Love&Sex Еда Media Games Auto&Moto Sport Hobby Flood Zone -Servant- Alternative Forums Forum -Garbage- Revolution Garbage Private . ... Рег.: ... Рейтинг: 254 . Оффициальная сеть . ... Из: MSU . Рейтинг: 5080 . Re: Оффициальная сеть [ re: Azeff ] . ... Re: Оффициальная сеть [ re: green ] . ...

Еще в разделе: (Показать все результаты (>4420) - www.snto-msu.net/ )

• как настроить smb.conf и запустить демоны smbd и nmbd? - Public forum of MSU
• Проблемы с MSDN, что c VS2005 Feb CTP - Public forum of MSU united student
• сервис чтобы полечать по мейлу www страничеки... - Public forum of MSU united

... Variations in soil acidity and in biodiversity were analysed in the National Natural Park "Russian North", European Russia. Improving soil quality from podzol, podzolic soil, derno-podzolic soil, brown earth to pararendzina leads to increase in diversity and changes in floristical composition, followed by changing of pine and spruce forest to mixed and birch forests. ... Our study shows that plants notably respond to soil acidification in boreal forest ecosystems. back . ...

Еще в разделе: (Показать все результаты (>32) - eco.soil.msu.ru/ )

• ASSESSMENT OF SOIL SUSTAINABILITY TO ACID DEPOSITION
• CRITICAL LOADS OF ACID DEPOSITION IN EUROPEAN RUSSIA
• Forest ecosystem data in Norwegian-Russian border area

... Микс 193 A 131 A 171 A 211 A 304 A Корона Магнитограмма . 211 + 193 + 171 . Description . ... LASCO (Large Angle and Spectrometric Coronagraph)- инструмент на космическом аппарате SOHO, поставляющий изображения солнечной короны, на которых свет, идущий непосредственно от Солнца, заблокирован с помощью искусственного затмения, создаваемого самим аппаратом. ... The form and the location of the magnetospheric boundary are defined by pressure balance of the solar wind and geomagnetic field. ...

Еще в разделе: (Показать все результаты (>1229) - swx.sinp.msu.ru/ )

... VaST is a software tool for finding variable objects on a series of astronomical images. ... VaST performs object detection and aperture photometry using SExtractor on each image, cross-matches lists of detected stars, performs magnitude calibration with respect to the first (reference) image and constructs a lightcurve for each object. ... VaST FITS image viewer ./pgfv . ... Part I" PZP, vol. ... K. V. Sokolovsky, S. A. Korotkiy; "New Variable Stars Discovered by the NMW Survey" PZP, vol. ...

160. Statistics One, Lecture 3, example script