... Second-year students classes . Introduction to Linux . ... 32-bit Microcontroller Programming . ... In the given practical special course we address user techniques for working with Linux OS; we study the interface of the command line in great detail, methods of automation and batch processing, composition of scientific articles as well as the specifics of software design by using in-built toolkit. ... Use of console interface of the command line, automation (bash scripts) . ...

Еще в разделе: (Показать все результаты (>28) - engineering.phys.msu.ru/ )

• Beginning of the classes
• Circuit Diagnostics
• MEMS Seminars, ST, Renesas

... General ideas of classical game-theoretic analysis: Game in normal form (as a model of players interaction) -Several participants (players) - Several possible strategies for each player -Payoff functions Principle of Nash equilibrium (as a method to define agents strategies during their interaction) -Nash equilibrium is a basic concept of game theory. ... If is not an equilibrium then mutants with pure strategy that is a best reply to have grater payoff than the average payoff for the main...

Еще в разделе: (Показать все результаты (>11) - io.cmc.msu.ru/ )

... In this paper we present a technique for authorship attribution based on a simple Markov chain of letters (i.e., just letter bigrams are used). ... We show that this technique provides excellent results when applied to over 380 texts from the Project Gutenberg archives, as well as to two previously published data sets. ... They examine the proportion of function words used by an author, and find that this is stable for each author, across a large number of writers in Russian. ... One Text . ...

Еще в разделе: (Показать все результаты (>59) - old.philol.msu.ru/ )

• Using Literal and Grammatical Statistics\\ for Authorship Attribution
• MSU-LGCLL:: O.V. Kukushkina, A.A. Polikarpov, D.V. Khmelev - Authorship
• Melnikov G.P.- Systemology and Linguistic Aspects of Cybernetics

HOTEL ACCOMMODATION IN MOSCOW We are glad to offer the accommodation for the conference participants in the following hotels. ... Breakfast: buffet table Price: Single room ґ 120 euro Single room comfort ґ 130 euro Double room ґ 140 euro Check-in 12:00, check-out 12:00 DEADLINE for booking and making payment is 1 May 2007 HOTEL Holiday Inn Lesnaya 4**** Address: Moscow, Lesnaya st., 15 Location: The Holiday Inn Moscow Lesnaya hotel is ideally located for both the business and leisure travelers. ...

Еще в разделе: (Показать все результаты (>117) - www.enzyme.chem.msu.ru/ )

• http://www.enzyme.chem.msu.ru/bc2007/Hotel_accommodation_in_St_Petersburg.pdf
• http://www.enzyme.chem.msu.ru/ekbio/article/UASB2006.pdf
• http://www.enzyme.chem.msu.ru/ekbio/article/dpfl_model.pdf

V.A. Morozov . Regularization Methods for Ill-Posed Problems . ... This monograph presents the theory and methods of approximate solutions of basic classes of ill-posed problems. It develops an abstract approach that is characterized by the following: widespread use of methods of functional analysis; concentration on general necessory and sufficient conditions of solvability and unique solvability of corresponding problems. The basic methods discussed is the methods of psendosolutions. ...

Еще в разделе: (Показать все результаты (>73) - srcc.msu.ru/ )

• Kazakevich, Olga. Documentation and description of the Northern Selkup local
• Rafaeva, Anna. Description of Propp's Roles in Russian Magic Folktales
• Kazakevich, Olga. Endangered Languages Documentation and Description: Should

A GENETIC ALGORHYTM FOR OPTIMIZING A NEURAL NETWORK CAPABLE TO LEARN FOR FOOD SEARCHING IN A RADIAL MAZE Budilova E.V., Chepurnova N.E., Chepurnov S.A, Teriokhin A.T. M.V.Lomonosov Moscow State University, Dept. of Biology. ... The upper platform has a hole in the middle and several radially directed tubular canals ("arms") each of which can contain a peace of food and has doors opening only in the centrifugal direction. ... The task of the animal is to visit only those arms which contain food. ...

Еще в разделе: (Показать все результаты (>21) - ecology.genebee.msu.ru/ )

• http://ecology.genebee.msu.ru/3_SOTR/CV_Terekhin_publ/2004_Birthweight_JEvolBio.pdf

... It is shown that theoretical methods developed for description of hopping transport in disordered inorganic solids, such as amorphous semiconductors, can also be successfully applied to description of hopping transport in organic disordered systems, such as conjugated or molecularly doped polymers. We concentrate our discussion on percolation approach and show its universal applicability to systems with different distributions of localized state energies. ...

Еще в разделе: (Показать все результаты (>57) - scon155.phys.msu.su/ )

• Generalized pair approximation in the description of ate AC conductivity of a

ORF ALEA CENTER FOR GL OB AL INTERNA TIONAL S TUDIES UNIVERSIT Y OF C ALIFORNIA, SANT A BARBAR A THE ROLE OF RELIGION IN GLOBAL CIVIL SOCIETY: THE MOSCOW WORKSHOP Lomonosov Moscow State University Moscow , Russia June 19, 2013 Sponsored by the Henry R. Luce Initiative on Religion and International Affairs Luce Moscow Workshop The Moscow workshop for the Or falea Center 's Luce Project on religion in ... Moscow State University has its own church of the Saint Tatiana. ...

Еще в разделе: (Показать все результаты (>59) - fgp.msu.ru/ )

• http://www.msu.ru/en/admissions/general-programs/docs/FACULTY%20OF%20GLOBAL%20STUDIES.pdf

... Полная версия этой страницы: Каррент мьюзик . Студенческий форум Физфака МГУ > Общий > ТРЕП > Карренты . ... True andЪ EvilЪ . ... Posted by 195.91.219.66. of WebWarper: see /han Example of using WebWarper: http://www.webwarper.net/ww/~av/forum.dubi...hp?showforum=42 ] . ... 11.12.2005, 12:31 . ... Posted by 195.91.219.66. of WebWarper: see /han Example of using WebWarper: http://www.webwarper.net/ww/~av/forum.dubi...dex.php?act=idx ] . ...

Еще в разделе: (Показать все результаты (>1848) - wasp.phys.msu.ru/ )

• Студенческий форум Физфака МГУ > Помогите разобраться с XML!
• Студенческий форум Физфака МГУ > Программирование
• Студенческий форум Физфака МГУ > Предствление Гейзенберга в случае

... The optimal control, which led oscillatory system to a certain energy level from any initial conditions at minimum time, is found. ... A set of points where the trajectory becomes an arc of a circle with the other center is called the switching line. ... For drawing switching line near the origin (see for example Figure 3) we note from the system (1) that time is proportional to the sum of the angles 214 this sums for optimal and quasi-optimal processes. ... The control function (14) is not optimal....

Еще в разделе: (Показать все результаты (>10) - belyakov.imec.msu.ru/ )

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>9) - storage.bioinf.fbb.msu.ru/ )

html head title Перемещение слоя в режиме drag /title script language= javaScript !-- var app; var szx = 0 ; var szy = 0 ; function start_drag () { app = document.applets.red; app.open_change_mode(0); rc = app.set_current_layer(' show '); if( rc==-1 ) {alert( Нет указанного слоя show ); return ;} app.set_ drag _layer( show ); drag (); ...

Еще в разделе: (Показать все результаты (>21) - adept.srcc.msu.ru/ )

• http://adept.srcc.msu.ru/adept/java/applet_book/ch_box/ch2text1.htm
• http://adept.srcc.msu.ru/adept/java/applet_book/drag/drag2text1.htm
• http://adept.srcc.msu.ru/adept/java/applet_book/ch_box/ch1text1.htm

... The following diets will be discussed: . ... michael kors outlet uk . ... 2016 С Днем Победы! ... win 7 ultimate product key Windows 8 key windows 7 key win 7 key windows 7 pro product key win 7 pro product key windows 7 activation key windows 7 ultimate product key windows 7 ultimate serial key windows 7 key online win 7 ultimate key win 7 serial keys Win 7 ultimate key Win 7 ultimate product key windows 7 key sale win 7 ultimate product Key ...

Еще в разделе: (Показать все результаты (>112) - elana.sinp.msu.ru/ )

• cheap michael kors Cyclacel Pharmaceuticals? CYCC CEO Spiro Rombotis on Q2 2015
• becoming one in the first women since you may have heard of stars like Trish
• cheap ralph lauren Fellowship of Christian Athletes Scholarships | С Днем

... Fast Facts about the Faculty of Journalism . ... Academic Departments . ... Full-time programs . ... Partners . ... All partners . ... Attraction of international students, development of cooperation with foreign partner universities is one of the priorities for the Faculty of Journalism. ... Foreign citizens can enter the Faculty of Journalism on a contract basis according to specific rules. ... Faculty of Journalism provides foreign applicants with a standard visa invitation. ...

Еще в разделе: (Показать все результаты (>42) - www.journ.msu.ru/ )

• The Second International Media Readings in Moscow :: Факультет журналистики МГУ
• The Second International Media Readings in Moscow
• International academic conference 'Ethnic Press - Genesis, Structure,

. Name . Last modified . Size . Description . about_center/ . 14-Sep-2013 14:31 . - . sections/ . 31-Oct-2007 14:46 . - . Apache/2.2.16 (Debian) Server at educenter.sinp.msu.ru Port 80

Еще в разделе: (Показать все результаты (>9) - educenter.sinp.msu.ru/ )

... Phys. 40 (2007) 2163-2177 doi:10.1088/0953-4075/40/11/017 Theoretical description of atomic photoionization by an attosecond XUV pulse in a strong laser field : effects of rescattering and orbital polarization A K Kazansky1,2 and N M Kabachnik1,3 ЕЕ Е Fakultat fur Physik, Universitat Bielefeld It is based on the numerical Е solving of the non-stationary Schrodinger equation which includes on an equal footing the realistic atomic potential and the electric fields of both pulses. ...

Еще в разделе: (Показать все результаты (>85) - danp.sinp.msu.ru/ )

• http://danp.sinp.msu.ru/LIIWM/PhysRevA56_1997_2848NMKab.pdf
• http://danp.sinp.msu.ru/LIIWM/PhysRevA73_06_062712Kabach_Kazanski.pdf
• http://danp.sinp.msu.ru/LIIWM/physscr_64_2001_53Khodyrev.pdf

Update on angular acceptance Bamberg , 19th September 2011 V. Kulikovskiy, Y. Yakovenko and H. Costantini Status at the Moscow Meeting Fixed some bugs in a geometry and mirrors Added a dynode stack in geometry description Implemented thin layer optical model Bamberg , September 2011 1 OM scans in Erlangen 4 scans x 2 OMs 8 scans that can be used as inputs in GEANT4 simulation to obtain collection efficiency ...

Еще в разделе: (Показать все результаты (>17) - antares.sinp.msu.ru/ )

... High Brightness RTM . ... Fig.1a: 70-MeV pulsed race-track microtron . Many applications require compact, inexpensive and efficient source of electron beam in energy range 10-100 MeV. ... Beam is focused by accelerating structure, which acts as RF quadrupole singlet, quadrupole triplets (12) installed at the even orbits return path and by electromagnet quadrupole singlet (9) installed at common axis. ... Fig.1b: 70-MeV RTM Schematic . ... Energy gain: 4.8 MeV / orbit . Orbits: 14 . ...

Еще в разделе: (Показать все результаты (>3) - vserv.sinp.msu.ru/ )

... In 1997, the work of Jens Skou devoted to discovery and the study of Na,K-ATPase was culminated in the Nobel Prize. ... Our group works in the collaboration with the University of Montrel, Canada (professor S.N. Orlov), and with the Engelgardt Institute of Molecular Biology, Moscow, Russia (Laboratory of conformational stability of proteins and physical methods of analysis, under the guidance of academician A.A. Makarov). ... S-glutathionylation of the Na,K-ATPase catalytic ? ... Biochemistry (Mosc)...

Еще в разделе: (Показать все результаты (>87) - biochem.bio.msu.ru/ )

• Biochemistry Department of Moscow State University | Teaching staff
• Probable participation of 14-3-3 in tau protein oligomerization and...
• Biochemistry Department of Moscow State University | Special curses

... Optimal networks appear as solutions of the fol lowing natural problem: How to connect a finite set of points in a metric space in an optimal way? We cover three most natural types of optimal connection: spanning trees (connection without additional road forks ), shortest trees and local ly shortest trees, and minimal fil lings. ... If this infimum attains at some set N , then each minimal spanning tree for this N is called a shortest tree or a Steiner minimal tree connecting M . ...

Еще в разделе: (Показать все результаты (>42) - dfgm.math.msu.su/ )

• http://dfgm.math.msu.su/files/0articles/Ilyutko/ilyutko-JKTR.pdf
• http://dfgm.math.msu.su/files/papers-sym/0503389v1.pdf