F1 ATPase NANO MOLECULAR MOTOR DYNAMICS DIPLOMA THESIS ABSTRACT Bulushova L.S. F0F1 ATPase nano-mo lecular motor dynamics is analyzed in the present paper. This nanomo lecular motor converts chemical energy into rotation energy of rotor ( subunit)­ the main part of F0F1 ATPase or vice versa. F1 ATPase is a part of the motor and it can work and transform energy independent ly. ... Kinemat ic links between an angle of the rotor turn and subunit closure angle are achieved. ...

Еще в разделе: (Показать все результаты (>82) - ofvp.phys.msu.ru/ )

• http://ofvp.phys.msu.ru/en/science_education/diploma/annot/2007/Kostylev_Cherezova_en.pdf
• http://ofvp.phys.msu.ru/en/science_education/diploma/annot/2015/Yakovlev_Zapunidy_en.pdf
• Laboratory of nonlinear polarization optics

... The philosophical consequences of synergetics, the interdisciplinary theory of evolution and self-organization of complex systems, are being drawn in the paper. ... Key words: complex systems, evolution, nonlinearity, pre-determination, self-organization, soft management, structure-attractors, synergetics 1. ... The spectra of possible, `allowed' structures correspond to sets of the eigenfunctions of the nonlinear equations describing the evolutionary processes in the complex system. ...

Еще в разделе: (Показать все результаты (>10) - www.students.chemport.ru/ )

• тест ?4 по английскому языку
• тест ?2 по английскому языку

... We present some results of new calculations of D" ( t ) the second derivative of the Moon's elongation as a function of time. ... Let X be a set of all preserved recordings of observations of ancient Sun and Moon eclipses (see the list in [ 2 ], pp. 167 271): let A be a set of eclipses described in X (any eclipse a A may have some records corresponding to it and form X ( a )). ... The recount of dates t ( a 0 ), a 0 A ,( 700) < t ( a 0 ) < (+400), was first made by N. A. Morosov. ...

Еще в разделе: (Показать все результаты (>93) - hbar.phys.msu.ru/ )

• R. R. Newton, "Two uses of ancient astronomy"

Development of new approaches to the analysis of ring shapes in organic molecules and the description of electronic distribution (atomic charges) and halogen bonding in the framework of forcefield model for rapid estimation of intra- and intermolecular interaction energies in molecular mechanics, molecular dynamics and docking methods . Forcefield is a model and a set of parameters for theoretical description of intra- and intermolecular interactions. ... 2016 Laboratory of Medicinal Chemistry ...

Еще в разделе: (Показать все результаты (>3) - qsar.chem.msu.ru/ )

VES visualization as the dependence Rho a =f ( r ) is suitable for analysis of only HLS . ... For that the special visualization program IPI-2D was developed, which helps to draw VES data in many forms. a) Rho a cross-sections for AMN & MNB pole-dipole arrays give the first representation of structure under investigation, its inhomogeneity and NSI influence (see fig.7 ). b) D - transformations gives the difference between AMN & MNB (D) and its horizontal derivative - dD/dX (R) . ...

Еще в разделе: (Показать все результаты (>67) - geophys.geol.msu.ru/ )

• TES. Modeling example.
• TES. Field example.
• TES tecnology. MSU.

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>9) - storage.bioinf.fbb.msu.ru/ )

• http://storage.bioinf.fbb.msu.ru/~roman/batmas30.pdf

... Results of experimental and numerical investigations of a permeable round parachute with the stripe-stabilizer, the so called "SAL" parachute - Stabilization of Aerodynamic Loads, are given [1]. ... The parachute canopy attained different shapes from each other depending on the value of reefing ( Fig.1 ). ... As given below some numerical investigations of the stripe-stabilizer reefing influence on the canopy shape, its aerodynamic drag and the tension of radial ribbons are considered. ...

Еще в разделе: (Показать все результаты (>5) - margaret.imec.msu.ru/ )

• On Square Parachute Differential Equations

... It has been indicated that pseudobreakups are characterized by a weak intensity of auroral activation and the field aligned flux of low energy electrons that caused this activation. ... The block of the LEPA satellite detectors measured fluxes of low energy electrons and ions from 50­100 eV to 20 keV [Hardy et al., ... The first generally accepted stage of substorm onset is an auroral burst (breakup) and an increase in field aligned electrons with energies of 0.5­5 keV that caused this burst. ...

Еще в разделе: (Показать все результаты (>215) - www.kosmofizika.ru/ )

• http://www.kosmofizika.ru/pdf2/cosr560_1.pdf
• http://www.kosmofizika.ru/pdf2/saa_e.pdf
• http://www.kosmofizika.ru/pdf2/scl_open_e.doc

. Laboratory Head: L.K.Gladilin, tel: (+7 495) 939 3568 , fax: (+7 495) 939 3064 , . Сотрудники Лаборатории (LHPR staff) . Web-pages: . L.K.Gladilin , . V.I.Rud , . I.A.Korzhavina , . Information for our Guests . Справка о создании и первом периоде работы лаборатории, подготовленная в 1980 г. Research Activities: . Scientific Information Search Engines : inSPIRE , ScienceResearch , Google Scholar . Scientific Servers : Interactions , AIP , Elements , Scientific . Feedback: Last modified on March 1, 2016.

Еще в разделе: (Показать все результаты (>10) - lhe.sinp.msu.ru/ )

• Atlas

... General ideas of classical game-theoretic analysis: Game in normal form (as a model of players interaction) -Several participants (players) - Several possible strategies for each player -Payoff functions Principle of Nash equilibrium (as a method to define agents strategies during their interaction) -Nash equilibrium is a basic concept of game theory. ... If is not an equilibrium then mutants with pure strategy that is a best reply to have grater payoff than the average payoff for the main...

Еще в разделе: (Показать все результаты (>11) - io.cmc.msu.ru/ )

• Кафедра Исследования Операций

The History Faculty at Moscow State University is pleased to invite students from all nations and peoples to consider studying history with us here in Moscow. Moscow State University strives to offer its students as many opportunities as possible for learning more about the world ? ... The History Faculty at Moscow State University is ready to welcome all interested students to make Moscow their home for a period, to study with us, and to reap the benefits of an international education. ...

Еще в разделе: (Показать все результаты (>6) - www.hist.msu.ru/ )

European Research Council IDEAS Coordination and Support Action (CSA) Call identifier: ERC -2009-SUPPORT Guide for Applicants Version: 16 July 2008 The Guide is published by the ERC -DIS on http:// erc .europa.eu It can also be downloaded from the CORDIS page on http://cordis.europa.eu European Commission FP7 Specific Programme IDEAS ... Consequently, the ERC needs to be rigorous in evaluating the very best science and researchers and in selecting innovative and "high risk/high gain" projects. ...

Еще в разделе: (Показать все результаты (>35) - ideas.msu.ru/ )

• http://ideas.msu.ru/docs/call_StG_2012.pdf