All PostScript files are compressed by gzip. ... Carrier transport and non-equilibrium phenomena in doped PbTe and related materials. - physica status solidi (a), 1993, 137 , 9-55 ( PostScript file ) ( PDF file ). ... Physics Reports, 1995, 257 , 85-131 ( PostScript file ) ( PDF file ). ... Phys., 1999, 86 , No 6, 3241-3246 ( PostScript file ) ( PDF file ). ... 1999, 14 , No 9, 852-856 ( PostScript file ) ( PDF file ). ... Вестник МГУ, Сер. физ., 2000, в.1, 39-43 ( PostScript file ) ( PDF file ). ...

Еще в разделе: (Показать все результаты (>15) - lizard.phys.msu.su/ )

... Фундаментальная библиотека ?. Для работы приложения на компьютере должны быть установлены ОС Windows XP/Vista или Windows 7 и следующие компоненты: .NET Framework 2.0 (x86) . Crystal Reports Basic for Visual Studio 2008 (x86, x64) . Логин для входа в систему kat1 , пароль 123 . ... Звоните нам по телефонам: (903) 16 16 516, (495) 939 3584. ... 119192, Москва, Ломоносовский проспект, 27, Библиотека E-mail : bks-mgu@yandex.ru Тел. 903) 16 16 5 16, (495) 939-35-84 . ...

Еще в разделе: (Показать все результаты (>5) - www.bks-mgu.ru/ )

. Welcome . to . Crimean Laboratory . of . Sternberg Astronomical Institute . Brief history . Some views from Crimean Observatory of SAI . Any questions or bug reports regarding this mirrow of main page of SAI Crimean Laboratory should go to M.G.Gavrilov.

Еще в разделе: (Показать все результаты (>11) - www.issp.ac.ru/ )

... Minimal size of Clud clusters (residues) . ... An alignment of a set of structures is a set of positions , to each position some atoms from different structures correspond. ... Hydrophobic cluster of a single protein structure is a separated pool of nonpolar atoms. Usually there is the biggest cluster in the protein called hydrophobic core. ... ConClus program is able to detect of conservative hydrophobic clusters for a family of related protein domains or just for a set of aligned proteins. ...

Еще в разделе: (Показать все результаты (>21) - mouse.genebee.msu.ru/ )

• Nhunt: program for nucleic acid sequence similarity search
• Align tool for DNA-protein complexes

... Abstract A Uniform Resource Identifier (URI) is a compact string of characters for identifying an abstract or physical resource. ... This document defines a grammar that is a superset of all valid URI, such that an implementation can parse the common components of a URI reference without knowing the scheme-specific requirements of every possible identifier type. ... URI-reference = [ absoluteURI | ... Otherwise, the reference URI's scheme is inherited from the base URI's scheme component. ...

Еще в разделе: (Показать все результаты (>4) - hea-www.harvard.edu/ )

• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/rfc2068.txt

Electronic Proposal Submission Service - EPSS preparation and submission guide - Release Date: 5 May 2008 Table of Contents 1 1 .1 . ... Using PIC in EPSS.. ... 29 EPSS help desk Phone: +32 2 23 33 760 Email: support@epss-fp7.org EPSS User Manual Released on 5 May 2008 page 2 of 29 1 EPSS Preparation ­User's Guide The EPSS (Electronic Proposal Submission Service) allows Proposers to create their proposal completely on-line without downloading or saving anything on their local personal computer. ...

Еще в разделе: (Показать все результаты (>27) - ideas.msu.ru/ )

• http://ideas.msu.ru/docs/guide_for_applicants_StG_2012.pdf
• http://ideas.msu.ru/docs/Guide_AdG_2011.pdf
• http://ideas.msu.ru/docs/Guide_SyG_2012.pdf

... ICONO Invited Speakers . ... Gennadiy Kulipanov, Budker Inst. of Nuclear Physics, Russia . ... Marlan Scully, Texas A&M Univ., ... Andrey Goncharov, Inst. of Laser Physics, Russia . ... Vladimir Trunov, Inst. of Laser Physics, Russia . ... Since 1987, he has worked at the National Research Council of Canada (Ottawa) in the field of laser physics and trapped ion optical frequency standards. ... Alexey Taichenachev , Inst. of Laser Physics, Russia . ... S. Vatnik, Inst. of Laser Physics, Russia . ...

Еще в разделе: (Показать все результаты (>6) - iconolat13.phys.msu.ru/ )

МГУ имени М.В.Ломоносова Русская версия . ... Science calendar . ... About Conference . ... Asian and African Studies . ... Art Criticism and History . ... Section Mathematics and mechanics . ... International Conference for Students and Young Scientists "Lomonosov" . ... 29 Feb 2016 . ... In April 2016 Lomonosov Moscow State University will hold the XXIII Lomonosov International Conference for Students and Young Scientists within the International scientific youth forum "Lomonosov-2016". ...

Еще в разделе: (Показать все результаты (>6) - conf.msu.ru/ )

... Construction of generating polynomials for residue codes of degrees 5-8 . ... Feynman integrals on functionals of the exponential type with polynomial degree . ... Complexity of realization of multi-valued logics functions by formulas of special type . ... Short trigonometric sums with not integer degree of natural number . ... One-dimensional liquid flow through a porous frame under interactive loads of the Darcy type and front pressure . ... Toggle formulas format . ...

Еще в разделе: (Показать все результаты (>107) - vestnik.math.msu.su/ )

• Vestnik Moskovskogo Universiteta. Seriya 1. Matematika. Mekhanika Вестник
• Vestnik Moskovskogo Universiteta. Seriya 1. Matematika. Mekhanika N 5/2010

... The Council on Complex Problems of Cosmic Rays of the Russian Academy of Sciences and the Skobeltsyn Institute of Nuclear Physics (SINP) of Lomonosov Moscow State University are planning to held a workshop "Cosmic Ray Physics Large Scale Experiments at the Second Decade of the 21st Century" on May 16-18 2011 at the Moscow State University. ... The Workshop banquet will be held on Tuesday, May 17 th . ... Workshop тАЬCosmic Ray Physics Large Scale Experiments at the Second Decade of the 21st Century"...

Еще в разделе: (Показать все результаты (>5) - tunka.sinp.msu.ru/ )

. SDPpred: a tool for prediction of amino acid residues . that determine differences in functional specificity of homologous proteins .

Еще в разделе: (Показать все результаты (>286) - monkey.belozersky.msu.ru/ )

... Data . ... Services . ... Solar energetic particles . ... N -d SW Conditions : Time profiles of the key geomagnetic ( Ap and Dst indices), solar wind (velocity V , density n and temperature T ) and IMF ( B , Bx , By , Bz in GSM) parameters observed in the N day vicinity of the geomagnetic disturbed day. N -d Map of Solar Events : Map of solar surface events occurred within N day vicinity of the moment when the solar wind expansion (which causes the geomagnetic event) started. ... WIND . ...

Еще в разделе: (Показать все результаты (>23) - smdc.sinp.msu.ru/ )

• Space monitoring data center
• Home - Space monitoring data center

. Name . Last modified . Size . Description . about_center/ . 14-Sep-2013 14:31 . - . sections/ . 31-Oct-2007 14:46 . - . Apache/2.2.16 (Debian) Server at educenter.sinp.msu.ru Port 80

Еще в разделе: (Показать все результаты (>9) - educenter.sinp.msu.ru/ )

... PAAC 54:8 - F PROVISIONAL RECG+IENDATIONS ON REPORTING ELECTRODE POTENTIALS IN NONAQUEOUS SOLVENTS a. GRITZNER1 and J. KiTA2 1lnstitute of Chemical Technology, University of Linz, Austria 2Ustav FyzikБlni Chemie a Electrochemie J. HeyrovskЙho, Praha, Czechoslovakia Abstract -- This report recceimends that the redox couples ferrocene/ ferricenium ion [ferrocene : bis(r --cyclopentadienyl )iron(II) and bis(biphenyl)chromiuin(I) /bis(biphenyl)chromium(O) be employed as reference redox systems. ...

Еще в разделе: (Показать все результаты (>58) - electr003.chem.msu.ru/ )

• http://www.elch.chem.msu.ru/rus/spec/Vvedenie_v_spetsialnost_1/Kielland.pdf
• Inorganic Barrier Layers: Electron Transfer on Mercury Modified by Tungstate

Homotopy types of moment-angle complexes based on joint work with Jelena Grbic, Stephen Theriault and Jie Wu Taras Panov Lomonosov Moscow State University The 39th Symposium on Transformation Groups Tokyo University of Science, Japan, 23­25 November 2012 Taras Panov (MSU) Homotopy typ es of m-a complexes Tokyo 24 Nov 2012 1 / 15 1. ... Taras Panov (MSU) Homotopy typ es of m-a complexes Tokyo 24 Nov 2012 2 / 15 2. ... The number of commutators of length Taras Panov (MSU) is equal to ( - 1) . ...

Еще в разделе: (Показать все результаты (>277) - higeom.math.msu.su/ )

• http://higeom.math.msu.su/people/taras/TTC/slides/kamiyama.pdf

Status of mTCA Slow Control development at CMS Petr Volkov Lomonosov Moscow State University Skobeltsyn Institute of Nuclear Physics, Russia 6/27/2015 P. Volkov SINP MSU 1 uTCA: Introduction MicroTCA® - open standard for fabric computer systems. MicroTCA systems are both physically small and non-expensive. ... Use PVSSII and the JCOP Framework to develop your control applications. These are the official CMS DCS developing tools. ... CMS_MTCA_HCALTR_CRATE1 CRATES.. ...

Еще в разделе: (Показать все результаты (>124) - qfthep.sinp.msu.ru/ )

• http://qfthep.sinp.msu.ru/proceedings2015/Collider_Volkov.pdf
• http://qfthep.sinp.msu.ru/talks2011/abssochish.pdf
• http://qfthep.sinp.msu.ru/talks/GRACEV2.pdf

... These approaches were: (1) laser photobleaching of a path through the centrosome; (2) direct observation of microtubules in centrosome-containing cytoplasts; (3) GFP-CLIP-170 expression as a marker for microtubule plus end growth; and (iv) sequential subtraction analysis. ... This result signifies that most MTs persistently grow from their time of birth at the centrosome until their plus end nears the cell margin. ... Growth of nascent MTs in CHO cells was not only persistent but rapid. ...

Еще в разделе: (Показать все результаты (>26) - cellmotility.genebee.msu.ru/ )

• http://cellmotility.genebee.msu.ru/html/articles/gorgidze98.pdf
• http://cellmotility.genebee.msu.ru/html/articles/jcs.pdf
• http://cellmotility.genebee.msu.ru/html/articles/jcs99.pdf

... Fiber optic hidrophones . ... A fiber optic air backed mandrel hydrophone to detect high energy hadronic showers in the water". ( text ) . ... The realization of an optic fiber air backed mandrel hydrophone for frequencies up to 20 kHz". ( text ) . M. Anghinolfi, A. Bersani, A. Calvi, A. Cotrufo, M. Ivaldi, O. Ershova, F. Parodi, D. Piombo, A. Plotnikov and L. Repetto "Measurement of the frequency responsivity of a fiber optic air backed mandrel hydrophone up to 10 kHz in air". ( text ) . ...

Еще в разделе: (Показать все результаты (>24) - antares.sinp.msu.ru/ )

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>8) - storage.bioinf.fbb.msu.ru/ )

... The which-path or both-path information of a quantum can be marked or erased by its entangled twin even after the registration of the quantum. ... One could even erase or mark the which-path information after the registration of the quantum and still determine its earlier behavior to be either wave or particle [6]. ... Photon 1, propagating to the right, is registered by detector D0 , which can be scanned by a step motor along its x axis for the observation of interference fringes. ...

Еще в разделе: (Показать все результаты (>139) - qi.phys.msu.ru/ )

• http://qi.phys.msu.su/papers/2007-jetpl(e)-85-297.pdf
• http://qi.phys.msu.ru/kulik/Papers/multimode.pdf
• http://qi.phys.msu.ru/kulik/Papers/nondeg_Bell.pdf