... Electronic journal Issue 4. 10 september 2004 Paliulis N., Chlivickas E. E-government as a Challenge of Public Management Development Introduction. ... This also includes the transfer of various data from hardcopies (documents) to digital media (databases), provision of information and services to citizens and businesses via electronic means (websites, e-mails, etc.) ... The main obstacle for the development of electronic public services is the small number of Internet users in Lithuania. ...

Еще в разделе: (Показать все результаты (>9) - e-journal.spa.msu.ru/ )

• http://e-journal.spa.msu.ru/uploads/vestnik/2004/vipusk_4._sentjabr_2004_g./briedis.pdf
• http://e-journal.spa.msu.ru/uploads/vestnik/2004/vipusk_4._sentjabr_2004_g./ulrich.pdf
• http://e-journal.spa.msu.ru/uploads/vestnik/2004/vipusk_4._sentjabr_2004_g./nekipelov.pdf

... However, our studies show that Prosilica EC650 has very good p erformance to use as DIMM image detector. ... The sub-directories /opt/dimm/data/out for the output data file, /opt/dimm/data/log for the output log file yymmdd-dimm.log and /opt/dimm/etc for the configuration file must b e created. ... Pictures mode The Pictures mode provides grabbing of the star b ox images and storing their sequence as one output file "b oxrecord.fits" in /opt/dimm/data/images/ sub directory. ...

Еще в разделе: (Показать все результаты (>22) - curl.sai.msu.ru/ )

• http://curl.sai.msu.ru/mass/download/doc/infrasoft_eng.pdf
• http://curl.sai.msu.ru/mass/download/doc/massug.pdf
• http://curl.sai.msu.ru/mass/download/doc/massug_eso.pdf

... id #527 . Journal of Biological Standardization [not defined] . Common information . ... no information] . ... since 1900-01-01 till today . ... http://www.sciencedirect.com/science/.. ... 1973-01-01 . 1989-12-31 . ...

Еще в разделе: (Показать все результаты (>186) - journals.genebee.msu.ru/ )

Summary Progress Report 2010 ­ 2014 UNESCO Chair on Global Problems and Emerging Social and Ethical Challenges for Large Cities and Their Population at the Faculty of Global Processes of the Lomonosov Moscow State University Period of activity: September 2010 June 2014 Title of the Chair : UNESCO Chair on Global Problems and Emerging Social and Ethical ... Visit of UNESCO Director-General Irina Bokova at Moscow State University September 9, 2011. ...

Еще в разделе: (Показать все результаты (>1563) - fgp.msu.ru/ )

• Search Results п¤п“пџ пњп“пе пёпј. пњ.п’. п›пѕпјпѕпЅпѕяЃпѕпІп°

European research in action THE SEVENTH ORK FRAMEW (FP7) PROGRAMME European Taking ch Resear refront fo to the Setting a new standard in European research The Seventh Framework Programme for research and technological development (FP7) is the European Union's main instrument for funding research in Europe. ... Nuclear research This specific programme comprises two parts ­ the first part focusing on nuclear fusion and the international ITER research facility which is to be constructed in Europe. ...

Еще в разделе: (Показать все результаты (>31) - ideas.msu.ru/ )

... It brought about the necessity for finding new methods of teaching literature to students of modern languages and new ways of forming their philological competence and developing their philological background knowledge. Key words: linguistic education, imaginative literature, philological competence, philological background knowledge, federal standards in linguistic education. ... 2004. ... 1999; Kukurian I. An Outline of English Literature (Against British Historical and Cultural Background). ...

Еще в разделе: (Показать все результаты (>55) - ffl.msu.ru/ )

• http://www.ffl.msu.ru/research/vestnik/4-2011-Ilson.pdf
• About Us

... Expanding and Retaining Customer Loyalty with Stefan Legner of InterNetX . Legner started with a brief history of InterNetX, a Regensburg, Germany based hosting and domain registrar provider that has more than 19,500 customers worldwide.He emphasized the need for companies to build long term partnerships, adding that business has always been about the relationship between people rather than companies .Where possible, Legner said that companies should provide an ... cheap the north face . ...

Еще в разделе: (Показать все результаты (>68) - elana.sinp.msu.ru/ )

• cheap ray bans uk as well as two kinds of noctilionid bats | С Днем Победы!
• I?m much more into talking than listening | С Днем Победы!
• September 26 | С Днем Победы!

Mathematics and the Arts by D. Crystal, Group 227, English teacher: D. Jones Lomonosov Moscow State University, Faculty of Mechanics and Mathematics 1. ... Mathematical achievements in science have made for today's common aesthetic artifacts such as music notes, fine art topology and authentic validation that used to be pure theoretical tools. ... Modern artists have benefited enormously from scientific investigation into mathematics of light and shade. ...

Еще в разделе: (Показать все результаты (>23) - www.eng.math.msu.su/ )

• http://www.eng.math.msu.su/download/theses3.pdf
• English test

... include stdio.h # include stdlib.h int main( int argc, const char* argv[]) { FILE* f; int c, wordCnt = 0, inWord = 0; if (argc 2) { printf ( Use: %s filename\n , argv[0]); return 1; } f = fopen(argv[1], r ); if (f == NULL) { printf ( Can't open file: %s\n , argv [1]); return 1; } while ((c = fgetc(f)) if (!isspace(c)) if (! inWord ) { ++wordCnt; inWord = 1; } } ... int main() { enum {RUNNING, STOPPED} state; state = RUNNING; state = STOPPED; } RUNNING STOPPED · : 1. ...

Еще в разделе: (Показать все результаты (>3) - savenkov.lvk.cs.msu.su/ )

... Lorem ipsum dolor sit amet, consectetur adipisicing elit, sed do eiusmod tempor incididunt ut labore et dolore magna aliqua. ... Lorem ipsum dolor sit amet, consetetur sadipscing elitr. ... Lorem ipsum dolor sit amet. Lorem ipsum dolor sit amet, consectetur adipisicing elit, sed do eiusmod tempor incididunt ut labore et dolore magna aliqua. <div class="myclass">...</div> . ... Lorem ipsum dolor sit amet, consetetur sadipscing elitr, sed diam nonumy eirmod tempor invidunt ut labore et dolore magna. ...

Еще в разделе: (Показать все результаты (>4) - physcontrol.phys.msu.ru/ )

• List All Categories

International Symposium - Speciation in Ancient Lakes , SIAL III - Irkutsk, September 2-7, 2002 65 Berliner PalДobiologische Abhandlungen 4 65 - 75 Berlin 2003 Achievements and Limitations of the K-Ar and 40Ar/39Ar Methods: What's in It for Dating the Quaternary Sedimentary Deposits? ... It is shown that the major problem for K-Ar method is in the plausible inequality of initially trapped argon isotopic composition in minerals of volcanic origin to the atmospheric 40 36 40 39 Ar/ Ar ratio of 295.5. ...

Еще в разделе: (Показать все результаты (>92) - hbar.phys.msu.ru/ )

• http://hbar.phys.msu.ru/hbar/pages/vyat/vyate.html
• http://hbar.phys.msu.ru/articles/ligorep97.pdf
• http://hbar.phys.msu.ru/hbar/pages/stefan/index.html

Doxyfile 1.4.6-NO # This file describes the settings to be used by the documentation system # doxygen (www.doxygen.org) for a project # # All text after a hash (#) is considered a comment and will be ignored # The format is: # TAG = value [value, .. ... USE_WINDOWS_ENCODING = YES # If the BRIEF_MEMBER_DESC tag is set to YES (the default) Doxygen will # include brief member descriptions after the members that are listed in # the file and class documentation (similar to JavaDoc). ... The default is NO. ...

Еще в разделе: (Показать все результаты (>13) - imaging.cs.msu.ru/ )

• http://imaging.cs.msu.ru/pub/2013.PRIA.Mamaev_Lukin_Yurin.HermiteNLM.en.pdf
• http://imaging.cs.msu.ru/files/courses/ipintro2012/Lec_Pt3_inpaint_my.pdf
• http://imaging.cs.msu.ru/pub/2013.PRIA.Levashov_Yurin.RidgeAndTree.en.pdf

... ICONO Invited Speakers . ... Gennadiy Kulipanov, Budker Inst. of Nuclear Physics, Russia . ... Marlan Scully, Texas A&M Univ., ... Andrey Goncharov, Inst. of Laser Physics, Russia . ... Vladimir Trunov, Inst. of Laser Physics, Russia . ... Since 1987, he has worked at the National Research Council of Canada (Ottawa) in the field of laser physics and trapped ion optical frequency standards. ... Alexey Taichenachev , Inst. of Laser Physics, Russia . ... S. Vatnik, Inst. of Laser Physics, Russia . ...

Еще в разделе: (Показать все результаты (>8) - iconolat13.phys.msu.ru/ )

• Housing and travel

... CpAppro . ... TernAPI program . ... Home Our Developments CpAppro . ... The above equation is a linear combination of thermodynamic functions of the harmonic oscillator (Planck-Einstein functions). This approach is developed as a part of a universal method of approximating temperature dependences of standard thermodynamic properties for crystalline substances. ... Colloquium on 24.12.12 20 Dec 2012 . ... Laboratory of Chemical Thermodynamics . ... 2000-2016 Laboratory of Chemical Thermodynamics . ...

Еще в разделе: (Показать все результаты (>12) - td.chem.msu.ru/ )

... We will dwell on linguistic aspects and Lexical Resources of POLITEXT branch having in mind some intermediate semantic representation of a whole text as the basis for differentiated Information Extraction. It is personal data (in the social sphere) recognition in texts that we focus on, see (Leontyeva et al. ... As the main instrument of semantic analysis of coherent texts this dictionary bears the important information on how to build BTF-units starting from lexemes of SemDict entries. ...

Еще в разделе: (Показать все результаты (>4) - leontyeva.srcc.msu.ru/ )

• Semantic Resources for Textual Content Compression

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>11) - storage.bioinf.fbb.msu.ru/ )

... Only by numerical simulation. ... moment T (K) Dipole moment (D) Experiment Other example: Diffusion constant 200 250 298 350 400 2.40 2.37 2.48 2.59 2.80 2.25 The Distribution functions: radial distribution function 1 g (r) = N t =1 j i N TS N pair ( r - rij ) The Distribution functions: radial distribution function CC def 2 Work mode ­ computer related 1) · Perform simulation , create trajectory file · Calculate properties timestep by timestep 2) · Perform ...

Еще в разделе: (Показать все результаты (>11) - www.elch.chem.msu.ru/ )

Create user account [Комиссия по практикуму, 3 семестр, 2015-2016] . login: . e-mail: . ... Use an existing account . To create an account, please think out, a login and provide your valid e-mail address in the form above. Then press the \"Create account\" button. Login may contain only latin letters, digits, . ... Use this password for the first log in. ... If you already have an ejudge account on this server, you may use it. If so, follow the link: Use an existing account . ...

Еще в разделе: (Показать все результаты (>6) - acm.msu.ru/ )

. Physical Faculty . Inverse problems of mathematical physics . A B Bakushinskii, A V Tihonravov, A G Yagola . Seminar takes place on Wednesday in 17:30 (small coference-hall in SRCC of MSU) All messages send to professor A G Yagola ( yagola@inverse.phys.msu.su , (095) 442-33-35).

Еще в разделе: (Показать все результаты (>29) - foroff.phys.msu.ru/ )

• Useful Information

... It was accomplish detail analysis of quantum cryptographic protocols, which most used in our days. ... Also we developed new methodology of distribution cryptographic keys between protocol users based on time-encoding corellated photon pairs emitted as a result of spontaneous parametric down-conversion on I-type nonlinear crystal BBO. It was built experimental scheme, which make distribution of key at distance about 8 meters between protocol users. ...

Еще в разделе: (Показать все результаты (>143) - ofvp.phys.msu.ru/ )

• http://ofvp.phys.msu.ru/en/science_education/diploma/annot/2013/Kashtanov_Zapunidi_en.pdf
• http://ofvp.phys.msu.ru/en/science_education/diploma/annot/2011/Trukhanov_Bruevich_en.pdf
• Laboratory of nonlinear polarization optics