... Effective Presentations . ... Read the following abstract and summarize the main points . ... And on a personal level, the ability to move the audience can shape the trajectory of a manager's career. ... You may open the presentation with a joke to get the audience's attention. Even if you write out your entire speech beforehand, you'll undoubtedly work to sound informal and conversational, possibly posing a few questions directly to the audience throughout the talk. ... Subject / title of talk. ...

Еще в разделе: (Показать все результаты (>9) - anazarenko.ffl.msu.ru/ )

• Факультет иностранных языков МГУ им.М.В.Ломоносова
• Бродецкая Александра

. Научно-образовательный центр Геномного секвенирования МГУ . Конкурс NGS-проектов ? > ? . Selection . File type icon . File name . Description . Size . Revision . Time . User . ? . polozhenie.pdf . View Download . љ . 30k . v. 2 . Jul 5, 2014, 2:53 AM . Yegor Bazykin . Comments . Sign in | Recent Site Activity | Report Abuse | Print Page | Powered By Google Sites .

Еще в разделе: (Показать все результаты (>3) - genseq.fbb.msu.ru/ )

... Mathematical models and methods in VLSI design . ... General models and statements about the complexity of combinatorial tasks, methods for development of fast algorithms (method of dynamic programming, ?divide and conquer?, ?method of model extension?) are considered. ... Mathematical models of contemporary electronic circuits are considered and basic approaches to solving task of logic synthesis, as well as tasks of VLSI modules placement and interconnection routing are described. ...

Еще в разделе: (Показать все результаты (>10) - hcs.cmc.msu.ru/ )

• Master program "Enterprise Information Systems" | Магистерское и послевузовское

... Biochem. J. (2002) 367 , (841–847) (Printed in Great Britain) . Engineering of coenzyme specificity of formate dehydrogenase from Saccharomyces cerevisiae . Alexander E. SEROV , Anna S. POPOVA , Vladimir V. FEDORCHUK and Vladimir I. TISHKOV 1 . ... Abbreviations used: D196A, Asp 196 Ala; D195S, Asp 195 Ser; FDH, formate dehydrogenase; CmeFDH, Candida methylica FDH; PseFDH, Pseudomonas sp.101 FDH; SceFDH, Saccharomyces cerevisiae FDH; Y197R, Tyr 197 Arg. ... Advertising Information . ...

Еще в разделе: (Показать все результаты (>95) - www.enzyme.chem.msu.ru/ )

• Entrez-PubMed

... defmacro defprinter ( name args &body body ) . ... body ) ) . ... defprinter :property ( type name &rest body ) . print-statement-with-body stream body nil "public ~a ~a" type name ) ) . ... defprinter :get ( &rest body ) . print-statement-with-body stream body nil "get" ) ) . ... defprinter :constructor ( name args &rest body ) . ... defprinter :class ( name &rest body ) . print-statement-with-body stream body t "public class ~a" name ) ) . ... defprinter :namespace ( name &rest body ) . ...

Еще в разделе: (Показать все результаты (>2) - depni.sinp.msu.ru/ )

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>11) - storage.bioinf.fbb.msu.ru/ )

... When embedded within a base document, a URL in its absolute form may contain a great deal of information which is already known from the context of that base document's retrieval, including the scheme, network location, and parts of the url-path. ... Introduction This document describes the syntax and semantics for "relative" Uniform Resource Locators (relative URLs): a compact representation of the location of a resource relative to an absolute base URL. ... 3.1) Base URL embedded in the | ...

Еще в разделе: (Показать все результаты (>4) - hea-www.harvard.edu/ )

• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/rfc2396.txt
• http://mirror.msu.net/pub/rfc-editor/rfc-ed-all/rfc1945.txt

... Robert Hermann Brookline, MA (Received November 22, 1999) der to illustrate the obvious progress, one can mention a variety of examples. ... In or- FYI Item "BMS Report on Institutes" As a member of the panel commissioned by the Board on Mathematical Sciences of the National Research Council, I write to correct several inaccuracies in the "For your information" note by Allyn Jackson entitled "BMS Report on Institutes" in the December 1999 issue of the Notices. ...

Еще в разделе: (Показать все результаты (>83) - chaos.phys.msu.ru/ )

• http://chaos.phys.msu.ru/loskutov/PDF/JSPstadium(t).pdf
• Loskutov's home page
• Dzhanoev's home page

... Electronic journal Issue 4. 10 september 2004 Briedis V. Pareto Structures A great Italian economist Vilfredo Pareto (1848 ­ 1923) in his unique economics and sociology studies [1, 2] continuously emphasised the systematic approach, reviewing the society development problems. ... Formal model of Pareto Structure First of all, provide a formal mathematical model adequately featuring the Pareto Structure. ... Indeed, I was primarily interested in the classical (harmonic structure) model at s = 1. ...

Еще в разделе: (Показать все результаты (>10) - e-journal.spa.msu.ru/ )

. Name . Last modified . Size . Description . Parent Directory . - . browse.css . 2008-10-28 19:46 . 805 . chime.css . 2008-06-05 17:58 . 408 . hfpage.css . 2008-06-05 17:58 . 1.1K . intermediate.css . 2008-06-05 17:58 . 92 . jmol.css . 2008-06-05 17:58 . 229 . scop.css . 2009-07-19 17:32 . 260 . style.css . 2009-07-19 16:23 . 3.8K . Apache/2.4.10 (Debian) Server at monkey.belozersky.msu.su Port 80

Еще в разделе: (Показать все результаты (>187) - monkey.belozersky.msu.su/ )

Update on angular acceptance Bamberg , 19th September 2011 V. Kulikovskiy, Y. Yakovenko and H. Costantini Status at the Moscow Meeting Fixed some bugs in a geometry and mirrors Added a dynode stack in geometry description Implemented thin layer optical model Bamberg , September 2011 1 OM scans in Erlangen 4 scans x 2 OMs 8 scans that can be used as inputs in GEANT4 simulation to obtain collection efficiency ...

Еще в разделе: (Показать все результаты (>20) - antares.sinp.msu.ru/ )

• http://antares.sinp.msu.ru/docs/Anisotropy_2011Bamberg.pdf

... Vestnik Moskovskogo Universiteta. Seriya 1. Matematika. Mekhanika. ...

Еще в разделе: (Показать все результаты (>89) - vestnik.math.msu.su/ )

• Vestnik Moskovskogo Universiteta. Seriya 1. Matematika. Mekhanika Instructions