... Could toads choose left or right side of the maze in experiment notwithstanding the position of odorant? Methods 36.8 cm 24.8 cm Paper with smell of Garter snake Area of smell center Area without smell Paper without smell of Garter snake Methods Paper without smell of Garter snake center Area Area without without smell smell Paper without smell of Garter snake We used 15 juvenile ...

Еще в разделе: (Показать все результаты (>58) - vertebrata.bio.msu.ru/ )

• http://vertebrata.bio.msu.ru/Shedlock_Okada_2000_BE.pdf
• http://vertebrata.bio.msu.ru/Poster_Gatilov.pdf
• http://vertebrata.bio.msu.ru/SINEs_RJG2002Eng.pdf

... 8 DOI: 10.1093/nar/gkh583 Mapping of the second tetracycline binding site on the ribosomal small subunit of E.coli Maria M. Anokhina1, Andrea Barta2, Knud H. Nierhaus3, Vera A. Spiridonova4 and Alexei M. Kopylov1,4,* Department of Chemistry ... University, 119992 Moscow, Russian Federation Received February 5, 2004; Revised March 22, 2004; Accepted April 14, 2004 1 ABSTRACT Tetracycline blocks stable binding of aminoacyltRNA to the bacterial ...

Еще в разделе: (Показать все результаты (>7) - rnp-group.genebee.msu.ru/ )

• http://rnp-group.genebee.msu.ru/pages/pdf/biochem2003.pdf
• http://rnp-group.genebee.msu.su/pdfs/MolBio6_00KopylovLO.pdf
• http://rnp-group.genebee.msu.ru/pages/pdf/biochem2002_1.pdf

... Opening of the educational programme - School of CEOs, "Capsule of security" for the key managers of Bashneft Group. ... April 11, 2013 - Bashneft Group in conjunction with JSFC "Sistema" opened the programme for the development of key Bashneft Group management - School of CEOs, "Capsule of security". ... At the end of his Welcoming Speech President of Bashneft Group stressed that this programme ? ... The School of CEOs ? ... 2006-2016 MSU Higher School of Management and Innovation. ...

Еще в разделе: (Показать все результаты (>5) - hsmi.msu.ru/ )

TB, SH, US, JPhysG/276799, 10/07/2008 IOP PUBLISHING J. Phys. G: Nucl. ... The ring-like and jet-like structures in two-dimensional angular histograms are well extracted by wavelet analysis both for toy models and in Monte Carlo simulated events of nucleusґnucleus collisions at LHC energies. ... We answer these questions by showing that the method of the wavelet analysis allows us to distinguish jets from rings and to find jet positions among the underlying backgrounds in Monte Carlo simulated events. ...

Еще в разделе: (Показать все результаты (>41) - lav01.sinp.msu.ru/ )

• http://lav01.sinp.msu.ru/~vlk/3pi0.ps
• http://lav01.sinp.msu.ru/nir/papers/NIM_3000-LGD.pdf

Sample Submission Form for Example Measurements In order to provide the best and most appropriate measurement/results, the customer is asked to please fill in the following form and enclose it with the sample. This form or equivalent information is required prior to the sample measurements. ... WITec can not provide specialised sample preparation. Measurement Goal: What's the goal of the measurement? ...

Еще в разделе: (Показать все результаты (>19) - nano.msu.ru/ )

... The kinetics of the ESR signal from P700 (ESR signal I) was recorded at different concentrations of exogenous ferredoxin, ,A kinetic model was developed for ferredoxin-dependent cyclic electron transport around photosystem I. A multiparticle model was built to directly describe electron transfer in multienzyme complexes and restricted diffusion of mobile carriers in individual compartments (stroma, lumen, intramembrane space) of the system. ... Ferredoxin Lumen Photosystem I Plastocyanin Fig. ...

Еще в разделе: (Показать все результаты (>36) - library.biophys.msu.ru/ )

• http://library.biophys.msu.ru/PDF/3329.pdf
• http://library.biophys.msu.ru/PDF/3336.pdf
• http://library.biophys.msu.ru/matorin/3371.pdf

... Наречные и причастные обороты . ... Длинные наречные обороты, стоящие в начале предложений, как правило отделяются запятыми: . ... In order to get the best results from your computer, you must follow the instruction manual carefully . ... Unfortunately the weather is bad . ... In order to punctuate well you have to feel a sentence's rhythm . ... You must follow the instruction manual carefully in order to get the best results from your computer . ... The weather is bad, unfortunately . ...

Еще в разделе: (Показать все результаты (>112) - num-anal.srcc.msu.ru/ )

• Другие соглашения об использовании запятых

... The shape of the spectra and the angular distributions of photoelectrons are considered in the near-threshold region for the case of photoelectronґAuger electron coincidence experiments as well as for noncoincidence measurements. ... For the case of innershell photoionization and the following Auger decay, we consider the triple differential cross section TDCS which is differential with respect to the energies of the both emitted electrons and the angle of the photoelectron emission. ... Phys. Usp. ...

Еще в разделе: (Показать все результаты (>111) - danp.sinp.msu.ru/ )

• http://danp.sinp.msu.ru/LIIWM/JPhysb40_2007_329.pdf
• http://danp.sinp.msu.ru/Articles_GSIB/nimb_smoothing_ZNOfilms_GCIB.pdf
• http://danp.sinp.msu.ru/LIIWM/PhysRevA56_1997_2848NMKab.pdf

Home . Database of structures of nucleic acid - protein complexes . ... List of complexes . Pfam families . SCOP families . Interaction classes . ... NPIDB . ... Information on SCOP and Pfam domains detected in protein chains is presented. ... Each family has its own web page with the list of entries that include domains of the family. ... List of SCOP domains occurred in DNA-protein and RNA-protein complexes is organized in tree-like form, according to the SCOP classification. ...

Еще в разделе: (Показать все результаты (>89) - npidb.belozersky.msu.ru/ )

• Index of /data
• Index of /data/html_scop
• Index of /data/pdb_new

... THE TIME HAS COME FOR "THUNDER BOOKS" . ... You may have forgotten what a thunder book is, or maybe you didn't ever use that name. ... It is a handy reference to those things you need to know about soils and how they behave. ... Well, if you knew how to use them as pages in a thunder book it would surely be a good start, but you need something uniquely yours. ... It has always been my belief that the mission of a soil survey is to help people understand and wisely use soil resources. ... Good read. ...

Еще в разделе: (Показать все результаты (>2) - www.paleopedology.msu.ru/ )

... Полная версия этой страницы: Каррент мьюзик . Студенческий форум Физфака МГУ > Общий > ТРЕП > Карренты . ... True andЪ EvilЪ . ... Posted by 195.91.219.66. of WebWarper: see /han Example of using WebWarper: /ww/~av/forum.dubinush...hp?showforum=42 ] . ... atz . ... Posted by 195.91.219.66. of WebWarper: see /han Example of using WebWarper: /ww/~av/lycos.com ] . ... Posted by 195.91.219.66. of WebWarper: see /han Example of using WebWarper: /ww/~av/forum.dubinush...dex.php?act=idx ] . ...

Еще в разделе: (Показать все результаты (>1357) - wasp.phys.msu.ru/ )

• Студенческий форум Физфака МГУ > феноменальное видео ! (знающим английский...
• Студенческий форум Физфака МГУ > Los Alamos Technical Reports and Publications
• Студенческий форум Физфака МГУ > вопросы соискателя

1== 1_EC_PurR -------- matikdvakranvstttvshvinktr --- fvaeetrnavwaaikelhyspsavarslkvnhtksigllatsse ------aayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllvmcseypepllamleeyrhipmvvmdwgeakad-ftdavidnafeggymagrylierg--hreigvipgplerntg ... -hrptavfcggdimamgalcaademg---lrvpqdvsligydnvrnaryftpalttihqpkdslgetafnmlldrivnkre--------epqsievhprlierrsvadgpfrdyrr--- 1_STY1692 -------- matikdvakranvstttvshvinktr --- ...

Еще в разделе: (Показать все результаты (>11) - storage.bioinf.fbb.msu.ru/ )

• http://storage.bioinf.fbb.msu.ru/~roman/bmc_genom_2013.pdf
• http://storage.bioinf.fbb.msu.ru/~roman/jbcb_2006.pdf

... 1, March 2008 (? 2007) DOI: 10.1007/s10884-007-9070-5 Hyperbolicity singularities in Rarefaction Waves Alexei A. Mailybaev 1,3 and Dan Marchesin 2 Received March 7, 2005; Revised March 20, 2006 For mixed-type systems of conservation laws, rarefaction waves may contain states at the boundary of the elliptic region, where two characteristic speeds coincide, and the Lax family of the wave changes. ... In these models, rarefaction curves typically contain a point at the boundary of the elliptic region. ...

Еще в разделе: (Показать все результаты (>30) - mailybaev.imec.msu.ru/ )

• http://mailybaev.imec.msu.ru/papers/KliemEtAl2006.pdf
• http://mailybaev.imec.msu.ru/papers/Mailybaev1999a.pdf
• http://mailybaev.imec.msu.ru/papers/Mailybaev2001.pdf

... Семинары . ... UNИX . ... Immutable Page . Comments . ... Attachments . More Actions: Raw Text Print View Render as Docbook Delete Cache ------------------------ Check Spelling Like Pages Local Site Map ------------------------ Rename Page Copy Page Delete Page ------------------------ My Pages Subscribe User ------------------------ Remove Spam Revert to this revision Package Pages Sync Pages ------------------------ Load Save SlideShow . ... Участие в семинаре. ...

155. http://belyakov.imec.msu.ru/papers/Belyakov_eng.pdf

156. http://genphys.phys.msu.su/rus/sci/photonics/PDF/4(en).pdf

157. http://ocean.phys.msu.ru/courses/stathyd/2001%20Ferrari%20et%20al.%2C%20The%20temperature-salinity%20relationship%20of%20the%20mixed%20layer.pdf

158. MSU Science Park - About us

159. http://ecology.genebee.msu.ru/3_SOTR/CV_Terekhin_publ/2003_Envir_human_EER.pdf

160. For three and half years of activity the participants of Ecological Cooperation