... Alternative core new atoms (%) . ... An alignment of a set of structures is a set of positions , to each position some atoms from different structures correspond. ... Geometrical core of a set of structures is a subset of alignment positions those atoms are disposed similarly in all structures. ... For any two positions included into geometrical core, the distances between CA atoms of those positions in all structures may differ not more than the value of the parameter "Distance spreading". ...

Еще в разделе: (Показать все результаты (>6948) - mouse.belozersky.msu.ru/ )

• NPG-explorer
• wLake program homepage

Space Weather Research in China and Introduction of CSSAR J. Cao (E-mail: jbcao@center.cssar.ac.cn) 1. ... Some important parameters of space environment are obtained, such as high energy charged particles (electrons, protons and heavy ions), single event upset, radiation dose, space plasma, surface charging, deep dielectric charging, upper atmosphere density and components, solar electromagnetic radiation and etc. ... The particle detectors soon detected the solar high energy particle fluxes. ...

Еще в разделе: (Показать все результаты (>23) - dbserv.sinp.msu.ru/ )

• BAFIZ
• 3d Map Description
• tunka_graph

Hybrid Molecular Mechanics : For Effective Crystal Field Method for Modeling Potential Energy Surfaces of Transition Metal Complexes M. B. DARHOVSKII/-2 M. G. RAZUMOV/ A. L. TCHOUGREEFF12 1 3 I. V. PLETNEV,2' 4 L. Y. Karpov Institute of Physical Chemistry , Moscow , Russia 2 Center for Computational Chemistry at the M. V. Keldysh Institute/or Applied Mathematics of RAS, Moscow , Russia 3N. S. Kurnakov Institute of General and Inorganic ... 2002 Wiley Periodicals, Inc. ...

Еще в разделе: (Показать все результаты (>28) - analyt.chem.msu.ru/ )

• Лаборатория Электрохимических Методов

List of Publications . ... Odoulov S,Tarabrova T, Shumelyuk S, Naumova II, Chaplina TO: Photorefractive response of bulk periodically poled LiNbO 3 :Y:Fe at high and low spatial frequencies. ... Evlanova N.F., Naumova I.I., Chaplina T.O., Blokhin S.A. and Lavrishchev S.V. Periodically poled Y:LiNbO 3 single crystal: impurity distribution and domain wall location, Journal of Crystal Growth, Vol. 223, ? 1-2, pp 156-160 (2001). ... Phys. Rev. Lett., 86, pp 4021-402 (2001). ...

Еще в разделе: (Показать все результаты (>2) - newcryst.phys.msu.ru/ )

... Length = 4702289 Score = 751 bits (1939), Expect = 0.0 Identities = 359/457 (78%), Positives = 409/457 (89%) Frame = -2 Query : 1 MSVQQIDWDLALIQKYNYSGPRYTSYPTALEFSEDFGEQAFLQAVARYPERPLSLYVHIP 60 MS I WDL+LIQKYNYSGPRYTSYPTALEFSED+ E AF QAV RYP+RPLSLYVHIP Sbjct : 3930889 MSEHAIVWDLSLIQKYNYSGPRYTSYPTALEFSEDYNESAFQQAVKRYPQRPLSLYVHIP 3930710 ...

Еще в разделе: (Показать все результаты (>7743) - kodomo.fbb.msu.ru/ )

• http://kodomo.fbb.msu.ru/~element/Term3/pm.txt
• http://kodomo.fbb.msu.ru/~element/Term3/blast_3.txt
• http://kodomo.fbb.msu.ru/~element/Term3/search_3T.txt

... The kinetics of the ESR signal from P700 (ESR signal I) was recorded at different concentrations of exogenous ferredoxin, ,A kinetic model was developed for ferredoxin-dependent cyclic electron transport around photosystem I. A multiparticle model was built to directly describe electron transfer in multienzyme complexes and restricted diffusion of mobile carriers in individual compartments (stroma, lumen, intramembrane space) of the system. ... Ferredoxin Lumen Photosystem I Plastocyanin Fig. ...

Еще в разделе: (Показать все результаты (>37) - library.biophys.msu.ru/ )

• http://library.biophys.msu.ru/PDF/3347.pdf
• http://library.biophys.msu.ru/PDF/3329.pdf
• http://library.biophys.msu.ru/PDF/3336.pdf

Welcome to K -corrections calculator, simple service allowing one to determine K -corrections of a galaxy, given its redshift and one or more colours. ... K -correction in choose filter.. ... Redshift . Colour choose colour.. Colour value . Calculator . ... calculate spectral energy distributions , K-corrections calculator , GALEX FUV NUV , UKIDSS YJHK , K-corrections of galaxies , spectral based k-corrections , SDSS filter set K-corrections , K correction code IDL , kcorrect IDL C , . ...

Еще в разделе: (Показать все результаты (>8) - kcor.sai.msu.ru/ )

• K-corrections calculator (version 2010)

... More Reports . ... Vocalization reflects type of social encounter in the dhole Cuon alpinus // Advances in Ethology, Contributions to the 3rd International Symposium on Physiology and Ethology of Wild and Zoo Animals. ... It was found that both tonal sounds of 70-500 ms duration with fundamental frequency under 1 kHz and high-pitched whistles of 6-9 kHz pitch occurred significantly more often spontaneously, during pacing, or during peaceful intrapair interactions. ... Research * Student Reports . ...

Еще в разделе: (Показать все результаты (>70) - vertebrata.bio.msu.ru/ )

• Выступления студентов и аспирантов на конференциях
• М.Ю. Соловьев

SKOBELTSYN INSTITUTE OF NUCLEAR PHYSICS (SINP) A.N. Ermakov, V.A. Khankin, Yu.A. Kubyshin, N.I Pakhomov, J.P. Rigla, V.I. Shvedunov DESIGN AND MAGNETIC MEASUREMENTS OF THE EXTRACTION MAGNET FOR 55 MeV RACE TRACK MICROTRON MSU-SINP Preprint No 2011-2/866 1 UDC 621.039 A.N. Ermakov, V.A. Khankin, Yu.A. Kubyshin, N.I Pakhomov, J.P. Rigla, V.I. Shvedunov E-mail addresses: shved@depni.sinp.msu.ru DESIGN AND MAGNETIC MEASUREMENTS OF THE EXTRACTION ... Magnetic screen system optimization.. ...

Еще в разделе: (Показать все результаты (>4) - sinp.msu.ru/ )

International Journal for Parasitology 32 (2002) 817-824 www.parasitology-online.com Host manipulation by Ligula intestinalis: a cause or consequence of parasite aggregation? ... Here we consider whether these behavioural changes are important in shaping the distribution of parasite individuals across the fish population. ... Keywords: Ligula intestinalis; Roach; Macroparasitic aggregation; Host manipulation 1. ... Inference of parasite-induced host mortality from distributions of parasite loads. ...

Еще в разделе: (Показать все результаты (>39) - ecology.genebee.msu.ru/ )

• http://ecology.genebee.msu.ru/3_SOTR/CV_Terekhin_publ/2004_Birthweight_JEvolBio.pdf

... Partial reaction, angular correlation) . ... Diff.cross section d/dA for thick target) . ... Partial differential cross section d/dA) . Partial diff. cross section d/dA * 4pi/Sigma) . ... Partial diff. cross section d/dA rel. to 90 deg) . ... S-factor for partial diff. cross section) . ... Partial diff. gamma em. cross section d/dA)(Diff.partial gamma-emission cross section) . ... Fission-product yield (assumed cumulative))(Fission product yield, assumed by compiler as cumulative) . ...

Еще в разделе: (Показать все результаты (>17) - cdfe.sinp.msu.ru/ )

• CDFE - Centre for Photonuclear Experiments Data - Home page
• CDFE provides the major photonuclear databases. Online Services.

... Head of the laboratory of amorphous and crystalline alloys of rare earth metals. ... Physics of magnetics, magnetic phase transitions, magnetic properties of rare earth compounds. ... Experimental study of the magnetic properties of rare earth alloys and compounds. ... Three-critical point on magnetic phase diagram was found in dysprosium and rare earth alloys. ... Giant magnetocaloric effect has been found in rare earth metals, Fe-Rh alloy and a series of intermetallic compounds. ...

Еще в разделе: (Показать все результаты (>25) - ferro.phys.msu.ru/ )

... Первая десятка | ... Первая десятка "Русского переплета" Темы дня: . ... PET: A Proton/Electron Telescope for Studies of Magnetospheric, Solar, and Galactic Particles. ... Geosciencies and Remote Sensing, 31, 535, 1993. ... 1 D T distributions, obtained in GAMMA-1, SAMPEX PET, MARIA-2 and ELECTRON experiments (M>4, D L< ± 0.1). Fig.2 D T distribution, obtained on board SAMPEX (M>5, D L< ± 0.05) . ...

Еще в разделе: (Показать все результаты (>164) - www.pereplet.ru/ )

• Super Ratio
• Quakes

EFFECT OF pH AND VFA ON H YDROLYSIS OF ORGANIC SOLID W ASTE By Adrie Veeken,1 Sergey Kalyuzhnyi,2 Heijo Scharff,3 and Bert Hamelers4 ABSTRACT: The anaerobic hydrolysis rate of organic solid waste was studied at fixed volatile fatty acid (VFA) concentrations ranging from 3 to 30 g COD/ L and fixed pH values between 5 and 7. ... In this way, it was possible to distinguish between the inhibitory effects of pH, total VFA, and undissociated VFA on anaerobic hydrolysis. ... VFA control. ...

Еще в разделе: (Показать все результаты (>142) - www.enzyme.chem.msu.ru/ )

• http://www.enzyme.chem.msu.ru/ekbio/article/biod98-9.pdf
• http://www.enzyme.chem.msu.ru/ryabov/pdf/MC_97.pdf
• http://www.enzyme.chem.msu.ru/ekbio/article/UASB2006.pdf

... Eagle Broadband Picks Terremark NAP . Eagle Broadband Picks Terremark NAPEagle says it selected Terremark NAP of the Americas because of its secure and reliable connection to customers throughout the US. The NAP of the Americas will serve as the central distribution hub for Eagle IPTV solution. this industry trend continues to get traction, we are delighted to welcome Eagle Broadband as one of the first IPTV distributors to our facility, says Manuel Medina, chairman and CEO of Terremark. ...

Еще в разделе: (Показать все результаты (>82) - elana.sinp.msu.ru/ )

PRL 105, 016001 (2010) PHYSICAL REVIEW LET TE RS week ending 2 JULY 2010 Random- Roughness Hydrodynamic Boundary Conditions Christian Kunert,1 Jens Harting,2,1 and Olga I. Vinogradova 1 2 3,4 Institute for Computational Physics, University of ... published 30 June 2010) We report results of lattice Boltzmann simulations of a high-speed drainage of liquid films squeezed between a smooth sphere and a randomly rough plane ... Squares are the results measured for a rough wall ( М 4%, r М 10x). ...

Еще в разделе: (Показать все результаты (>31) - nanofluidics.phys.msu.ru/ )

• http://nanofluidics.phys.msu.ru/paper/asmolov-vinogradova-2012.pdf
• http://nanofluidics.phys.msu.ru/paper/jcp2008.pdf
• http://nanofluidics.phys.msu.ru/paper/jcp2012_1.pdf

... OCEAN ACOUSTICS. ... It is proposed to use high frequency resolution methods of sonographic analysis (spectral­ time representation) of projections of the acoustic power flux vector for spatial resolution of sources that pro vide a higher signal to noise level at the output of the processing system. ... The problem of obtaining an acoustic image is extremely difficult, since the required spatial source resolution at low frequencies is usually several times smaller than the acoustic wavelength. ...

Еще в разделе: (Показать все результаты (>53) - acoustics.phys.msu.ru/ )

• http://acoustics.phys.msu.su/teachers/rudenko_files/98sweisarv.pdf
• http://acoustics.phys.msu.su/teachers/gusev_files/nano2.pdf
• http://acoustics.phys.msu.su/teachers/gusev_files/diff2011.pdf

... Полная версия этой страницы: STATISTICA (Excel устроит) . Студенческий форум Физфака МГУ > Наука физика > Есть проблема . Free Researcher . 16.1.2007, 15:44 . ... лично меня бы устроило написать тупую прогу, которая все посчитает и запишет в файл. ... Там есть такая функция СЧЕТЕСЛИ, два аргумента - столбец, в котором считать и критерий. ... СЧЕТЕСЛИ(C1:C14;">A1")-СЧЕТЕСЛИ(C1:C14;"<B1")+СЧЕТЕСЛИ(D1:D14;">A1")-СЧЕТЕСЛИ(D1:D14;"<B1") . ...

Еще в разделе: (Показать все результаты (>359) - wasp.phys.msu.ru/ )

• Студенческий форум Физфака МГУ > black drop effect проявление аберрации
• Студенческий форум Физфака МГУ > Barclays Capital 2009
• black drop effect проявление аберрации - Студенческий форум Физфака МГУ

... A This result can be applied to a wide variety of data sets, including electricity bills1, street addresses, lengths of rivers, physical and mathematical constants, and processes described by power laws. ... Based on the plausible4 assumption that people who make up figures tend to distribute5 their digits fairly uniformly, a simple comparison of first-digit frequency distribution from the data with the expected distribution according to Benford's law had to show up any anomalous results. ...

Еще в разделе: (Показать все результаты (>17) - www.eng.math.msu.su/ )

• http://www.eng.math.msu.su/download/dictionary.pdf
• http://www.eng.math.msu.su/download/Model_rendering.pdf

JOURNAL OF APPLIED PHYSICS VOLUME 86, NUMBER 6 15 SEPTEMBER 1999 The rate of radiative recombination in the nitride semiconductors and alloys Alexey Dmitrieva) and Alexander Oruzheinikov Department of Low Temperature Physics, Faculty of Physics, M. V. Lomonosov Moscow State University, Moscow, 119899, Russia Received 7 January 1999; accepted for publication 27 May 1999 The radiative recombination rates of free carriers and lifetimes of ... Phys., Vol. ... We will see in the Sec. ...

Еще в разделе: (Показать все результаты (>16) - lizard.phys.msu.su/ )

• http://lizard.phys.msu.su/home/science/rec-GaN.ps.gz
• http://lizard.phys.msu.su/home/science/Masyukov-Dmitriev-11-JAP-InN.pdf
• http://lizard.phys.msu.su/home/science/redistr-sst99.pdf